ada

Probable adenosine deaminase

772 amino acids

Catalyzes the hydrolytic deamination of adenosine. Plays an important role in purine metabolism and in adenosine homeostasis, and may thereby contribute to cellular signaling events (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

87.516 kDa

MIENNKEITLDIIKLLPKAELHRHLDGSIRISTLLELAKEQNVELPTYDQNELAKLIHKDENCSGLVNFLEAFQYTCSVLQHAYAITRVFYEMCEDAVADGVSYLEIRFSPVLHTSFGLSLSEVMEAVCDGMAIAELNLPIKARIIVCGLRHLDPSISKDLAEITWRYRHKGAIAFDLAGPEDGFSSKHHKEAFSIIRNKGINCTLHSGEDSNWTSVADSIHHCGAHRIGHGIAIQQNEELLNHVVNRRIPIECCITSNYQIKAISNASEHPIRKYFDSGAIVSICCDNCTMSNITLSGEYKLAIDTFNFKVEEVIRLIDYSFASSFIDPPLKINIRRESFKKALKIFQTNGYDISGVIENKFYYFEEIGLDVELEIQNNLANNFSLGKNVIRNYPQITLELLENLPKSDLHCRFDGGVSIEQIWNEVQLLGIDKCEKSKQEFLKKLSSKHLACYANFKDFKEFKSLIQSSSHTPQTIRLSKEIINLLLQTPEQINRAFDDIIKVALKDKVQYLELMIRPNSHSRNGLTKEQVLALIIENKDKWEKSSSIKIGLVVFSSSTSDDPIETLDSARLAIANRNSGVIGFGIFGADPISPTESRHFSQTFSLLKENNFNLVQFAGKSDVESLISTIHCSGSTRLSGAFQSHKIPRLMSYLGNYSIPVEISLTEKLKSFTSDDLSFTTPIRHLLDGKCPVVICSFRSSLYPYSRSKMYYKIVKNAKLDFKQVVRLLKNPFAYNFQSHQQRIELVQQFNKLSKEYLNSVNINYSNIII

ADA

Adenosine deaminase

363 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (By similarity). Plays an important role in purine metabolism and in adenosine homeostasis (By similarity). Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events (By similarity). Acts as a positive regulator of T-cell coactivation, by binding DPP4 (By similarity). Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (By similarity). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (PubMed:23240012). Enhances CD4+ T-cell differentiation and proliferation (By similarity). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (By similarity). Stimulates plasminogen activation (By similarity). Plays a role in male fertility (By similarity). Plays a protective role in early postimplantation embryonic development (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

40.919 kDa

MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL

ADA

Adenosine deaminase

363 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (PubMed:8452534, PubMed:16670267). Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4 (PubMed:20959412). Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (PubMed:11772392). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (By similarity). Enhances CD4+ T-cell differentiation and proliferation (PubMed:20959412). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (PubMed:23193172). Stimulates plasminogen activation (PubMed:15016824). Plays a role in male fertility (PubMed:21919946, PubMed:26166670). Plays a protective role in early postimplantation embryonic development (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

40.764 kDa

MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAGQNL

ada

Adenosine deaminase

359 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

40.844 kDa

MNGKPAFDKPKVELHVHLDGAIRLKTVLDVAKRRGISLPVSMEEELKELCTVNEPATLTEFLGKFSHFMHVIAGDREAIKRIAYEFVETKAKEGVIYVEARYSPHFLANKGVEPLPWDQKPGDITPDDVVDLVNQGFKEGEQAFKTKARSILCCMRHMPNWSMEVVELCKKFHKDGVVAIDLAGDESMNCESYPGHKKAFEEAVRSNVHRTVHAGEVGPASVVREAVEVLKAERIGHGYHTLEDQNLYKQLLHQNMHFEMCPVSSRLTGACEPDFTKHPLITFKKDKANYSLNTDDPTIFNSTLNSDYEVVQKYMDFTEEEFKRLNINAAKSCFLPEKEKEKLLNQLYEAYGMRKSTSF

ada

Adenosine deaminase

358 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

40.676 kDa

MESKAFNKPKVELHVHLDGSIKPETIIHFAKKRQIKLPADTVEGLLEHVSYKEPLSLTEFLQKFNHYMPAIAGDREAIKRIAYEFVEMKAKEGVIYVEVRYSPHFLANSKVDPIPWGQKEGDITPDEVVDLVNQGLRKGEKTFNIKARSILCCMRHMPNWSSEVIELCKKYQNDTVVAIDLAGDESLNCESYPGHRKAYEEAVKCGIHRTVHAGEVGPPSVVKEAVEVLKAERIGHGYHTTEDPNLYKELLENNMHFEVCPWSSYLTSACHPDFTKHPATQFRKDKANFSLNTDDPLIFGSTLDVDYSIAVQHMGFTEDEFKRVNINAAKSSFLPDNEKKELLYKLYEAYGMILSTGL

ada

Adenosine deaminase

358 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

40.555 kDa

MESKAFNKPKVELHVHLDGSIKPETIIHFAKKRQIKLPADTVEGLLEHVSYKEPLSLTEFLSKFNHYMPAIAGDREAIKRIAYEFVEMKAKEGVIYVEVRYSPHFLANSKVEPIPWGQKEGDITPDEVVDLVNQGLRKGEKAFNIKARSILCCMRHMPSWSTEVVELCKKYQNDTVVAIDLAGDESLNCESYPGHRKAYEEAVKCGIHRTVHAGEVGPSSVVKEAVEVLKAERIGHGYHTTEDPNLYKELLEKNMHFEVCPWSSYLTGACHPDFTKHPATQFRKDKANYSLNTDDPLIFGSTLDVDYSIAAKHMGFTEEEFKRVNINAAKSSFLPESEKKELLYKLYEAYGMILSTGL

ADA

Adenosine deaminase

357 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

40.679 kDa

MERGVRVFGEPKVELHIHLDGAIRPETILHFGKKRGVPLPGSTVDELMKHVSYQTPLSLKLFLEKFNHYMPAIAGDREAVRRIAYELVETKAKEGVVYVEVRYSPHLLANCRVEPIPWGQAEGDLTPEEVVNLVNQGLQDGERNFRIKARSILCCMRHMPSWSPEVVELCKKYQNNSVVAIDLAGDELLMASSDHKAAYEEAERCGIHRTVHAGEAGPATMIKEAVYLLKAERIGHGYHVLEDPELYRELLRTRMHFEVCPWSSYLTGACLPDFRKHPVVQFKKDQANYSINTDDPLIFNSNIDKDYGIVKEYMDFTEEDFKRVNINAAQSSFLPEKEKQELLNTLYEAYGMVPATS

ada

Bifunctional transcriptional activator/DNA repair enzyme Ada

354 amino acids

The methylation of Ada by methylphosphotriesters in DNA leads to its activation as a transcriptional regulator that activates the transcription of its own gene, ada, and other alkylation resistance genes, alkA, alkB and aidB.

In the C-terminal section; belongs to the MGMT family.

39.324 kDa

MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPEKANAQQHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRARRLRESLAKGESVTTSILNAGFPDSSSYYRKADETLGMTAKQFRHGGENLAVRYALADCELGRCLVAESERGICAILLGDDDATLISELQQMFPAADNAPADLMFQQHVREVIASLNQRDTPLTLPLDIRGTAFQQQVWQALRTIPCGETVSYQQLANAIGKPKAVRAVASACAANKLAIIIPCHRVVRGDGTLSGYRWGVSRKAQLLRREAENEER

ada

Regulatory protein ada

353 amino acids

The methylated ADA protein acts as a positive regulator of its own synthesis, as well as that of other proteins. The transcription-activating function of the ADA protein resides in its N-terminus. It activates the transcription of alkA, alkB and aidB.

In the C-terminal section; belongs to the MGMT family.

39.348 kDa

MMKKALLIDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQQRRLDKIACACRLLEQETPVTLAFLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFPDSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDDALLAELHTLFPSARHEPADALFQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIPCHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

Ada

Adenosine deaminase

352 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (PubMed:9272950). Plays an important role in purine metabolism and in adenosine homeostasis (PubMed:9272950, PubMed:10720488). Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events (PubMed:11435465). Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (By similarity). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (By similarity). Enhances CD4+ T-cell differentiation and proliferation (By similarity). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (By similarity). Stimulates plasminogen activation (By similarity). Plays a role in male fertility (By similarity). Plays a protective role in early postimplantation embryonic development (PubMed:9272950).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

39.992 kDa

MAQTPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLYREYQ

Ada

Adenosine deaminase

352 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion. Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion. Enhances CD4+ T-cell differentiation and proliferation. Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change. Stimulates plasminogen activation. Plays a role in male fertility. Plays a protective role in early postimplantation embryonic development.

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

39.899 kDa

MAQTPAFNKPKVELHVHLDGAIKPETILYYGKKRGIDLPADTVEGLRNIIGMDKPLSLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPIPWNQAEGDLTPDEVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSPEVLELCKKYHQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVKDGIHRTVHAGEVGSAEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWNPKTTHAVVRFKDDQANYSLNSDDPLIFKSTVDTDYQMVKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLERLYKEYQ

Ada

Adenosine deaminase-like protein

337 amino acids

Putative nucleoside deaminase. May catalyze the hydrolytic deamination of adenosine or some similar substrate and play a role in purine metabolism (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

37.576 kDa

MEQFLKGLPKVELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFSRFEKDMDACFEKFAFVHELTSTREGLRFATELAIRDFAEDNVQYVEMRTTPKANENYSRRDYLQIVIDAIKAASETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLHFGMSRCGHGTFLTPEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQIQMADRVGNYADILVK