Description
Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation (By similarity).
Family
Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.
Sequence
MERGVRVFGEPKVELHIHLDGAIRPETILHFGKKRGVPLPGSTVDELMKHVSYQTPLSLKLFLEKFNHYMPAIAGDREAVRRIAYELVETKAKEGVVYVEVRYSPHLLANCRVEPIPWGQAEGDLTPEEVVNLVNQGLQDGERNFRIKARSILCCMRHMPSWSPEVVELCKKYQNNSVVAIDLAGDELLMASSDHKAAYEEAERCGIHRTVHAGEAGPATMIKEAVYLLKAERIGHGYHVLEDPELYRELLRTRMHFEVCPWSSYLTGACLPDFRKHPVVQFKKDQANYSINTDDPLIFNSNIDKDYGIVKEYMDFTEEDFKRVNINAAQSSFLPEKEKQELLNTLYEAYGMVPATS
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service