whiB2

Transcriptional regulator WhiB2

129 amino acids

Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity).

Belongs to the WhiB family.

14.396 kDa

MSYESGDFDRVVRFDNRLLGSVSHAPHIDTGSTPTGAAGRPQLSLVPDSFDVAPEAEEDQWQERALCAQTDPEAFFPEKGGSTREAKRICQGCEVRDACLEYALAHDERFGIWGGLSERERRRLKRGII

whiB2

Transcriptional regulator WhiB2

99 amino acids

Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity).

Belongs to the WhiB family.

11.747 kDa

MWGVVDDSAEEPWHELWGLFRPDGDVSWQHKALCAQTDPEAFFPEKGGSTRDAKRVCAKCEVREQCLKWAIDHDERFGIWGGMSERERRRYKREHRERA

whiB2

Transcriptional regulator WhiB2

89 amino acids

The apo-form functions as a chaperone, preventing aggregation or helping in correct refolding of a number of substrates; this activity does not require ATP or the ability to bind a Fe-S cluster. Chaperone activity is insensitive to the redox state of its cysteine residues. The apo-form has no protein disulfide reductase activity. The apo-form binds to its own promoter.

Belongs to the WhiB family.

10.157 kDa

MVPEAPAPFEEPLPPEATDQWQDRALCAQTDPEAFFPEKGGSTREAKKICMGCEVRHECLEYALAHDERFGIWGGLSERERRRLKRGII

whiB2

Transcriptional regulator WhiB2

89 amino acids

The apo-form functions as a chaperone, preventing aggregation or helping in correct refolding of a number of substrates.

Belongs to the WhiB family.

10.157 kDa

MVPEAPAPFEEPLPPEATDQWQDRALCAQTDPEAFFPEKGGSTREAKKICMGCEVRHECLEYALAHDERFGIWGGLSERERRRLKRGII