Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity).

Belongs to the WhiB family.

99 amino acids

MWGVVDDSAEEPWHELWGLFRPDGDVSWQHKALCAQTDPEAFFPEKGGSTRDAKRVCAKCEVREQCLKWAIDHDERFGIWGGMSERERRRYKREHRERA

11.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make whiB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here