ubl4aa

Ubiquitin-like protein 4A-A

154 amino acids

Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region (By similarity).

16.884 kDa

MILTVKPLQGKECNVQVTEDEKVSTVKELVSERLNIPASQQRLLYKGKALADEHRLSDYSIGPEAKLNLVVRPAGERSGVAGMASSSSAVGGVWQTLSTVLAKHFSPADAAKVQEQLVKDYERSLRQLSMDDIERLAGRLLHPDSEGMDTSYMD

ubl4aa

Ubiquitin-like protein 4A-A

154 amino acids

Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region (By similarity).

16.923 kDa

MILTVKPLQGKECNVQVTEDEKVSTVKELVSERLNIPANQQRLLYKGKALADEHRLSDYSIGPEAKLNLVVRPAGERSGVAGMASSSSAVSGVWQTLSTVLAKHFSPADAAKVQEQLVKDYERSLRQLSLDDIERLAGRLLHPDSEGMDTSYMD