Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region (By similarity).

154 amino acids

MILTVKPLQGKECNVQVTEDEKVSTVKELVSERLNIPANQQRLLYKGKALADEHRLSDYSIGPEAKLNLVVRPAGERSGVAGMASSSSAVSGVWQTLSTVLAKHFSPADAAKVQEQLVKDYERSLRQLSLDDIERLAGRLLHPDSEGMDTSYMD

16.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ubl4aa using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here