smpB

SsrA-binding protein

211 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

24.747 kDa

MHRRSSKSYSSRNSKTPERSKIPDCVIASNKSAEYNYFLDKTFEAGLVLLGSEVKSVRQQKISLSEAYIYEDNSEIWLANLYIPEHKTGGWTNHNPRRLRKLLLHKYQIARLRKDLLIPGITLVPIKFYFRNGRAKLLISLARGKKLIDKREVIKEREATLEANRALKHRLRRPRAQRNTQRSVTPRSTRENKNVQRNKARSARCNVRHEN

smpB

SsrA-binding protein

211 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

24.786 kDa

MHRRSSKSYSSRNSKIPERSKIPDCVIASNKSAEYNYFLDKTFEAGLVLLGSEVKSVRQQKISLSEAYIYEDNSEIWLANLYIPEHKTGGWTNHNPRRLRKLLLHKYQIARLRKDLLIPGITLVPIKFYFRNGRAKLLIALARGKKLIDKREVIKEREATLEANRALKHRLRRPRAQRNTQRSVTPRRTRENKNVRGSKARSARRNVRREN

smpB

SsrA-binding protein

189 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

21.784 kDa

MAKSKKKSSGTSSNVIALNRKARHDYFIEERYEAGLVLEGWEVKSLRAGRVQLNEGYCLLKGGEVWLFGVHLSPLNTVSTHIHPDPLRTRKLLLHAKELRKLIGAVERKGYALIPLTLYWKRGRVKLEIALAKGKQKYDKRATEKEKEWTRQKERLLKVHKFTRRGLPALAGRGIGILRKFVVFRQKSM

smpB

SsrA-binding protein

184 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.748 kDa

MAAKKSTPTDSGKSKGKKNKAQKGAGQKGAGQIVVATNRKARHDYHIIDTYECGVVLVGTEVKSLREGKASLVDAYATIDEGEVWLRGLHIPEYSMGHWTNHSPRRTRKLLLHRREIDSLMGKVRDGNNTLVPLQLYFVAGKLKVELALARGKQEYDKRQDIKRRTEEREITREMGRRIKGIQG

smpB

SsrA-binding protein

183 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.803 kDa

MAKKATLVDHGAAKGKKKAQSKVSKKNANKRLVVATNRRARHDYTILDTWEAGIQLVGTEVKSLREGKASLIDSFATIDDGEVWLRHLHIPEYSKGHWTNHSPRRTRKLLLHRNEIDSIMGKVRDGNNTLIPLSLYFSDGKLKVELALGRGKQDYDRRQDIKRRTEEREATRALGRRVKGLTG

smpB

SsrA-binding protein

178 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.098 kDa

MAKKSTPVDSGRSKGKKASAPRGGGPAVIATNRKARHDYHILDTYECGVVLVGTEVKALREGKASLVDAYATIDAGEVWLRGLHIPEYSRGNFWNHTPRRVRKLLLHRREIDSLTGKVRDGNHTLVPLQLYFVDGRLKCELALARGKQDYDKRQDIKRRTEEREVVRELGRKIKGMKG

smpB

SsrA-binding protein

177 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.047 kDa

MYVPKESQPKQGGGASGKVKDGKRKIVAQNKKARHDYAIIDTYEAGLVLTGTEVKSLRQGRASLTDGFVQIDGNEAWLHNAHIPEYSQGTWTNHTVRRKRKLLLHREEIDKLASKSEETGHTIVPLALYFKDGRAKAEIALARGKKEYDKRQTLREKQDRRESDRAIAAAKRKQRGE

smpB

SsrA-binding protein

176 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.934 kDa

MTEAGAKKAAGKKSGKGKGKNAKKNQPNITPVAENRKAKFRYEILDSVECGMMLMGSEVKSMREGKLSLDEAHIRVTNGELWLVGSDIAHYNNAGMWNHDPRRPRKLLVHAKEFDKFAGRAFERGLTLIPLRVYFSERGLAKCVMGLVKGKKLHDKRETIKKRESDRGLQRAMRRK

smpB

SsrA-binding protein

175 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.847 kDa

MTRNPQPDRSKTAPKNAKRDPVASGERDASVNRAASHNYFLLDKYEAGVALRGTEVKSIRDGRANLKDAYGLVKENELWLINAHIGPYDAASYNNHAPLRTRKLLVKKREILKLLAASQQKGHTLIPTRMYFKNGRVKVELAVAKGKQLWDKRETDRRKTADRDAREAIARSRKS

smpB

SsrA-binding protein

175 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.283 kDa

MFFGERFFTTAMAKVSNKANKIIKKEAVFKRLSENRYAKFQYEILETIEAGIELLGTEVKSIRNGSVNLRDGYCSFRDGEILLLNVHISPHKNVGPFFNHDPLRNRKLLLHKKEIVKLKYNTEKKGLTIIPLSIYLKGSWIKLTIGIGKGKKLHDKRQADKQRDIKREIKTALKR

smpB

SsrA-binding protein

172 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.294 kDa

MHYARIVSNLHLGYDIIHMAEYVTLTTNRKAFHNYFLEEKYEAGIMLLGTEIKSLRSGRVNMGDAYVKPQRGELWLVNAHISAYECSGHTSHEPMRERKLLMHRKEIALLMSKVKEKGLTLIPVRIYLKNDIAKVELSLGRGKKLYDKRDTITKRDTERELEREVKYRNFRR

smpB

SsrA-binding protein

172 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.327 kDa

MHYARIVSNLRLGYDIIHMAEYVTLTTNRKAFHNYFLEEKYEAGIMLLGTEIKSLRSGRVNMGDAYVKPQRGELWLVNAHISAYECSGHTSHEPMRERKLLMHRKEIVLLMSKVKEKGLTLIPVRIYLKNDIAKVELSLGRGKKLYDKRDTVTKRDTERELEREVKYRNFRR

smpB

SsrA-binding protein

172 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

20.299 kDa

MHYARIVSNLRLGYDIIHMAEYVTLTTNRKAFHNYFLEEKYEAGIMLLGTEIKSLRSGRVNMGDAYVKPQRGELWLVNAHISAYECSGHTSHEPMRERKLLMHRKEIALLMSKVKEKGLTLIPVRIYLKNDIAKVELSLGRGKKLYDKRDTVTKRDTERELEREVKYRNFRR

smpB

SsrA-binding protein

169 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.955 kDa

MAKGSGRAKAAGGKGGSKQIIATNRKARHNYSIIETYEAGVALQGTEVKSLREGQASLADAFATIDDGEVWLRNLYIPEYQHGSWTNHDPRRNRKLLLHRQQIDRLVGKIRDGNLALMPLSLYFSEGKVKVELALARGKKAYDKRQDLAQRDAQREVVRQLGRRTKGMI

smpB

SsrA-binding protein

168 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.845 kDa

MAAKKAGKAGATKDRNNQVVASNRRARHNYAILDTYEAGIALMGTEVKSLRDGQASLADAFATVDDGEIWLRNLHIPEYQHGSWTNHAPRRNRKLLLHRREIDNLIGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDLARRDAEREVVRELGRRAKGMS

smpB

SsrA-binding protein

168 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.845 kDa

MAAKKAGKAGATKDRNNQVVASNRRARHNYAILDTYEAGIALMGTEVKSLRDGQASLADAFATVDDGEIWLRNLHIPEYQHGSWTNHAPRRNRKLLLHRREIDNLIGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDLARRDAEREVVRELGRRAKGMS

smpB

SsrA-binding protein

168 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.845 kDa

MAAKKAGKAGATKDRNNQVVASNRRARHNYAILDTYEAGIALMGTEVKSLRDGQASLADAFATVDDGEIWLRNLHIPEYQHGSWTNHAPRRNRKLLLHRREIDNLIGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDLARRDAEREVVRELGRRAKGMS

smpB

SsrA-binding protein

168 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.136 kDa

MAAQSKQAKPSGKQGGKKIIATNRKARHNYSIIEVFEAGVALQGTEVKSLRERHASLVDAFATVDDGEVWLRNLHIPEYLHGTWTNHEPRRNRKLLLHRRQIDTLFGKIREGNFALVPLSMYFLDGKVKVELALARGKHAHDKRQDLARRDAQREVIRELGRRAKGMG

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.05 kDa

MSKNSVKDKAKSATANKTIALNKRARHEYHIEERFEAGLALQGWEVKSIRAGRGNIIDAYAYVKQGEIFLIGAQITPLIQASTHVVANDRRERKLLLHRSEIDKLVGKVERDGYTIVPTAMYWSKNKIKLEVALAKGKQTHDKRDAAKDRDWAIEKQRVMRRGNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.017 kDa

MSKNSGKDKAKSATANKTIALNKRARHEYHIEERFEAGLALQGWEVKSIRAGRGNIIDAYAYVKHGEIFLIGAQITPLIQASTHVVANDRRERKLLLHRSEIDKLVGKVERDGYTIVPTAMYWSKNKIKLEVALAKGKQTHDKRDAAKDRDWAIEKQRVMRRGNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.255 kDa

MSKKQTKDKANGAKATKTIALNKRARHEYHLEERYEAGLALQGWEVKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHTVPVERRDRKLLLHRAEIDKVLSRVEREGYTLVPTALYWSSNKVKLEIALAKGKQNHDKRDAAKDRDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.269 kDa

MSKKQTKDKANGAKATKTIALNKRARHEYHLEERYEAGLALQGWEVKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHTVPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQNHDKRDAAKDRDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.224 kDa

MSKKPAKDKAKSATATKTIALNKRARHEYHLEERYEAGLALQGWEVKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHVIPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQSHDKRDAAKERDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.224 kDa

MSKKPAKDKAKSATATKTIALNKRARHEYHLEERYEAGLALQGWEVKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHVIPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQSHDKRDAAKERDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.224 kDa

MSKKPAKDKAKSATATKTIALNKRARHEYHLEERYEAGLALQGWEVKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHVIPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQSHDKRDAAKERDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.293 kDa

MNKKPTKDKANGAKATKTIALNKRARHEYHLEERYEAGLALQGWEIKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHTVPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQNHDKRDAAKERDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.266 kDa

MSKKPTKDKANGAKATKTIALNKRARHEYHLEERYEAGLALQGWEIKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHTVPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQNHDKRDAAKERDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.266 kDa

MSKKPTKDKANGAKATKTIALNKRARHEYHLEERYEAGLALQGWEIKAIRAGRANIVDGYAYVRSGEIYLIGAQITPLIQASTHTVPVERRDRKLLLHRAEIDKVLTRVEREGYTLVPTALYWSSNKVKLEIALAKGKQNHDKRDAAKERDWQRDKQRVMRRHNRDA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.664 kDa

MAKGGVKKAAAAAARAAANRLMADNRQARHQYEILETLETGIELVGTEVKSIRNGKANLRDGFCLIRNGELQLHNVHISPHSHASAYFNHDPLRTRKLLAHRREIDKLRGQLDKKGLALIPLNIHLKGSWIKITIGVGKGRKLHDKRAADKEKQSKKEVRSAMAKYQ

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.393 kDa

MNNKHPKNKAKSTTTPKTIALNKRARHEYHLIERHEAGLELQGWEVKAIRAGRANLGDGYAYVRDGEIFLIGAQITPLIQASTHVVANDRRTRKLLLHRHQIDTLIGRVQREGFTLVPTAMYWSKNRVKMEIALAKGKQAHDKRHAEKEREWQRDKQRIMRAHNRNA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.427 kDa

MNNKHPENKAKSTTTPKTIALNKRARHEYHLIERHEAGLELQGWEVKAIRAGRANLADGYAYVRDGEIFLIGAQITPLIQASTHVVANDRRTRKLLLHRRQIDTLIGRVQREGFTLVPTAMYWSKNRVKMEIALAKGKQAHDKRHAEKEREWQRDKQRIMRAHNRNA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.412 kDa

MNNKHPKNKAKSTTTPKTIALNKRARHEYHLIERHEAGLELQGWEVKAIRAGRANLGDGYAYVRDGEIFLIGAQITPLIQASTHVVANDRRTRKLLLHRRQIDTLIGRVQREGFTLVPTAMYWSKNRVKMEIALAKGKQAHDKRHAEKEREWQRDKQRIMRAHNRNA

smpB

SsrA-binding protein

167 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.393 kDa

MNNKHPKNKAKSTTTPKTIALNKRARHEYHLIERHEAGLELQGWEVKAIRAGRANLGDGYAYVRDGEIFLIGAQITPLIQASTHVVANDRRTRKLLLHRHQIDTLIGRVQREGFTLVPTAMYWSKNRVKMEIALAKGKQAHDKRHAEKEREWQRDKQRIMRAHNRNA

smpB

SsrA-binding protein

166 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.142 kDa

MTKKKNKKVTKSERGEANRRLAENRLARHQYEILETLETGIELVGTEVKSIRAGNTNLRDGFCLIREGELQLHNVHISPLNNAGNFFNHDPLRTRKLLAHRKEINKLEIQVARKGLTLIPLSIHLKGSWIKIIIGVGKGRKLHDKREDDKRKQANRDMKSALARYR

smpB

SsrA-binding protein

166 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.455 kDa

MAKGGAKKAAAAAARAAANRMLADNRQARHQYEILETLETGIELVGTEVKSIRNGKANLRDGFCLIRNGELQLHNVHISPHSHAGAYFNHDPLRTRKLLAHRREIDKLRGQLDQKGLALIPLNIHLKGSWIKLTIGLGKGRKLHDKRAAEKEKQSKKEVKAAIARF

smpB

SsrA-binding protein

166 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.978 kDa

MAGKGKGAKAAAKKRLEAQKLLADNRQARHQYEILDTLETGIELLGTEVKAIRAGKANLRDGFCLIRQGQLQLHNVHIAGHEQASRYFNHEPLRVRRLLAHRREIDKLRGQLDTKGLTLIPLNIHLKGSWIKLTIGLGKGRKLHDKRQEERRKQDQKDLRSALKRL

smpB

SsrA-binding protein

166 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.59 kDa

MAKGGAKKAAAAAARAAANRMLADNRQARHQYEILETLETGIELVGTEVKSIRNGKANLRDGFCLIRNGELQLHNVHISPHTHAGNYFNHDPLRTRKLLAHRREIDKFRGLVDQKGLTLIPLSLQLKGSWIKLTIGLGKGRKLHDKRAAEKEKQSKKDVKAAMERY

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.695 kDa

MSSKSGGAKKKAGDGRKIIADNRKARFNYSIGETFEAGIELKGSEVKSLRTGQGSLNEAYAQVTRTGEVMLVNAYIPIYLQANQFNHETRRPRKLLLHKREIEKLAAAVQRQGMTVVPLRMYFTDKGRVKVEIGLAQGKKLADKRETLKERSWERDKARLMREKG

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.875 kDa

MSAKGAGGARGRGAEGEKIVATNRRARFDFTIEDSWEAGLVLTGSEVKSLREGNVNLSDAYALPRGDELFLVNCRIGEYKQAAHFGHEPLRDRKLLMNRPELDRVKGKIEQRGYTLVPLRLYFKQGWAKVELGLAKGRSHEDRRHAIAERETKREMDREISRRRR

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.055 kDa

MSKKGKKKSKNNSSVDGNRRLAENRQARYEYEILETLETGLELLGTEVKSIRAGKVNLKDGFCLIKKDQIQLHNVHISPHNHAGKFFNHEPLRIKRLLAHRKEIEKLKISLERKGLTIIPLSLYLKGSWIKLKIGVGKGRKTHDKRDREKINDSKRDVANALKRF

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.629 kDa

MAKGGNKKATAAARAAANRLLADNRLARHQYEILDTLETGIELVGTEVKSIRAGQANLRDGFCLIRKGELQLHNVHISPHSHAGSYFNHDPLRTRKLLAHRREIDKLRGQLDRKGLTLIPLNLHLKGSWIKLTIGLGKGRKLHDKRQEEKRKQADREVKSALARY

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.97 kDa

MIAKVSNKSNKSNKKEAVFKRLAENRYAKFQYEISETIEAGIELLGTEVKSIRNGNVNLRDGYCSFRDGEILLLNVHISPHKNVGSFFNHDPLRNRKLLLHKKEIFKLKSNTEKKGLTIIPLSIYLKGSWIKLTIGIGKGKKLHDKRQADKQKDIKREIKTALKR

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.019 kDa

MSKARNNKKSKLSKAKSNRRLAENRYARHQYEILEDIEAGIELLGTEVKSIRAGNVNLRDGFCLIREGSLLLHNVHISPFNNAGSFFNHEPLRVRKLLAHRKEINKLETQVNRKGLTLVPLNIFLKGSWIKITIGLGKGRKLHDKRENEKRKQSEREVKSALARY

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.615 kDa

MAKGGNKKATAAARAAANRLLADNRLARHQYEILDTLETGIELVGTEVKSIRAGQANLRDGFCLIRKGELQLHNVHISPHSHAGSYFNHDPLRTRKLLAHRREIDKLRGQLDRKGLTLIPLNLHLKGSWIKLTIGLGKGRKLHDKRQDEKRKQADREVKSALARY

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.067 kDa

MSKKGKKQSKNNSSVDGNRRLAENRQARYEYEILETLETGLELLGTEVKSIRAGKVNLKDGFCLIKKDQIQLHNVHISPHNHAGKFFNHEPLRIKRLLAHRKEIEKLKISLERKGLTIIPLSLYLKGSWIKLKIGVGKGRKIHDKRDREKINDSKRDVANALKRF

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.735 kDa

MAKKPKAVKDSNNQVVATNRKARHNYSILDTYEAGIALMGTEVKSLREGQASLADAFATVDDGEIWLRNLHIPEYHHGTWTNHAPRRNRKLLMHRREIDNLVGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDMARRDAQREVTRELGRRVKGMTS

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.456 kDa

MAKGGGKKSAAAARAAANRLLADNRLARHQYDILETLETGIELVGTEVKSIRAGQANLRDGFCLIRNGELQLHNVHISPHTHASGYFNHDPLRVRRLLAHRREIDKLRGQLDQKGLTLIPLNLHLQGSWIKLTLGLGKGRKLHDKRAAEKDKQIKKETRAALSRY

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.198 kDa

MAKNNKKIKTSLNIIALNKKARHNYFIEQTLEAGLSLEGWEVKSLRDSKVQIKESYVILKNNELFLFGAHISPLKSVSTHVNSDSTRTRKLLLNRLEINRIKDNINQKGATIVPLKLYWARGKVKLEIGMAKGKKSHDKRQDIKLKDWQRDKQRTLKETNKIFNF

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.992 kDa

MRPVSKKAGKSKKTEGNVIALNRKAGFDFFVEERLEAGLALEGWEVKALRAKRVNLTESHVLVRRGEAWLIGCNITPLSTASTHIHPDPTRTRKLLLHRREINRLIGAVDRDGYTVVPLKLYWKRGRAKIEIGVAKGKKKQDKRADKKEQDWQRQRERLLKHKVS

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.694 kDa

MAKKPKSVKDTNNMVVASNRKARHNYSILETYEAGVALVGTEVKSLRDGTASLADAFATVDDGEIWLRNLHIPEYHHGSWTNHAPRRNRKLLMHRREIDNLVGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDMARRDAQREVTRELGRRVKGMTN

smpB

SsrA-binding protein

165 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.899 kDa

MVKKNSKSAKNASATIARNKRATFEYRIEDKIEAGLQLMGWEVKSIRMGKVNLSDCYVYIKEGEAFMHGCTIQPLNTASTHVVCDPIRTKKLLLKRSEIDKLAGLIERQGYTLIPLSMYWRKGAWVKVEIGLGKGKKDHDKREDTKEREWKIEKARVMKKDKVGA

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.005 kDa

MAKKKKKVDENNSVLATNRKARHDYHIIDTWEAGVVLLGTEIKSLREGKVSLVDSFATIDNGEIWLQHLHIPQYSMGSWTNHTPKRTRKLLLHRNEIDSLMGKVRDGNRTLVPLKLYLKNGRVKLELGLAQGKQDYDKRQDIKRRTEEREVTRELGRRIKGINA

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.005 kDa

MAKKKKKVDENNSVLATNRKARHDYHIIDTWEAGVVLLGTEIKSLREGKVSLVDSFATIDNGEIWLQHLHIPQYSMGSWTNHTPKRTRKLLLHRNEIDSLMGKVRDGNRTLVPLKLYLKNGRVKLELGLAQGKQDYDKRQDIKRRTEEREVTRELGRRIKGINA

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.935 kDa

MAKKKKKVDENNQVLATNRKARHDYQILDTWEAGVVLLGTEIKSLREGKASLVDAFAVIDNGEVWLHNLHIPTYSMGSWTNHSPKRTRKLLLHRREIDSLMGKVRDGNRTLVPLKLYLVNGRVKLELGLAQGKQDYDKRQDIKRRTEEREVTRELGRRIKGINA

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.364 kDa

MAGKKTKSGMISHGMAAQNRKGRFDYTILETTEAGIVLKGPEVKSLRLGRATITEAYAAERDGEIWLFNSYIPEYQGGVLSRFEPRAPRKLLMHRKQIAHFLGAVSRAGASLVPLDIHFNARGMAKVTLGLGQGRRKEDKRHAIAERDWKRDKARLVRSSGKDY

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.864 kDa

MAKKNAKKSKNSSASIARNKRATFDYKFEEKMEAGLSLMGWEVKSIRMGKVNLSESYVFMREGEAFLFGCTIAPLNTASTHVVCDPMRSRKLLLKRKELDKLQGLVDRKGYSIVPISMYWQKGAWVKIEIGLGKGKKEHDKRDDTKDREWQIEKARTMKKAVQQ

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.704 kDa

MAKNSKKVKSNTNKANNFKLLAENRYAKFQYAISETIEAGIELLGTEVKSIRNGKANLRDGYCSFRDGEILLLNVHISPHKNVGSFFNHDPLRNRKLLLHKKEIIKMKSNTEKKGMTIVPLSLYLKGSWIKITLGVGKGKKLHDKRQDEKQKSIKKEINSALKR

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.844 kDa

MAKTSNKVKRNANKANIFKLLADNRYAKFQYEISETIEAGIELLGTEVKSIRNGKANLRDGYCSFRDNEILLLNVHISPHKNVGSFFNHDPLRNRKLLLHKKEIIKMKSSTEKKGMTIVPLNLYLKGSWIKLTIGVGKGKKLHDKRQDEKQKSIKREINSALKR

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.888 kDa

MAKNSNKVRKNTNKENNFKRLAENRYAKFQYAISETIEAGIELLGTEVKSIRNGKANLRDGYCSFRDGEILLLNVHISPHKNVGSFFNHDPLRNRKLLLHKKEIIKLKSNTEKKGMTIVPLSMYLKGSWIKLTLGVGKGKKLHDKRQDEKQKSIKKEINSVLKR

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.717 kDa

MAKNSNKVKKNTNKANNFKLLADNRYAKFQYAISETIEAGIELLGTEVKSIRNGKANLRDGYCSFRDGEILLLNVHISPHKNVGSFFNHDPLRNRKLLLHKKEIIKMKSNTEKKGMTIVPLSLYLKGSWIKLTIGVGKGKKLHDKRQDEKQKSIKKEINSALKR

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.5 kDa

MGKGGGKKSAAARAAANRLLADNRLARHQYEILETLETGIELLGTEVKSVRAGQANLRDGFCLIRRGELHLHNVHISPHTHASRYFNHDPLRVRRLLAHRREIDKLRGHLEQKGLTLIPLNLHLQGSWIKVTIGLGKGRKLHDKRAAAKDKQVKKETRDAIARY

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.78 kDa

MAKKNAKNSKNSSASIARNKRATFDYKFEEKLEAGLSLMGWEVKSIRMGKVNLSESYVFLREGEAYLFGCTIAPLNTASSHVVCDPLRSRKLLLKRKELDKLQGLVDRKGYSIVPISMYWQKGAWVKIEIGLGKGKKEHDKRDDTKDREWQIEKARTIKKAVQQ

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.78 kDa

MAKKNAKNSKNSSASIARNKRATFDYKFEEKLEAGLSLMGWEVKSIRMGKVNLSESYVFLREGEAYLFGCTIAPLNTASSHVVCDPLRSRKLLLKRKELDKLQGLVDRKGYSIVPISMYWQKGAWVKIEIGLGKGKKEHDKRDDTKDREWQIEKARTIKKAVQQ

smpB

SsrA-binding protein

164 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.85 kDa

MAKKNAKKSKNSSASIARNKRATFDYKFEEKMEAGLSLMGWEVKSIRMGKVNLSESYVFMRDGEAFLFGCTIAPLNTASTHVVCDPMRSRKLLLKRKELDKLQGLVDRKGYSIVPISMYWQKGAWVKIEIGLGKGKKEHDKRDDTKDREWQIEKARTMKKAVQQ

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.721 kDa

MEQISSKEGEIYMAGKKILATNKRARHEYFIEETYECGIELKGTEVKSIRQGKVNLSDGFASVDNSEVFLKQVHISPYEQGNIFNVDSLRVRKLLLHKHEIRKLIGATTIKGYSLIPLSLYLKNGKVKVEIALAKGKKLYDKRQDMAKKDAQRRIEREMTGKY

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.524 kDa

MKGKAGGKAADAAEKVAASNRRARFDYDVEDTWEAGLVLTGSEVKSLREGNVNLSDAYAMPRGEELWLLNCRIGEYQQAAHFGHAPLRDRKLLMNRAEIDRVRGKVEQRGYTLVPLRIYFKQGWAKVELGLARGRSHEDRRGAIAERESKREMDRALARGRRR

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.538 kDa

MKGKAGGKAADAAEKVAASNRRARFDYDIEDTWEAGLVLTGSEVKSLREGNVNLSDAYAMPRGEELWLLNCRIGEYKQAAHFGHAPLRDRKLLMNRAEIDRVRGKVEQRGYTLVPLRIYFKQGWAKVELGLARGRSHEDRRGAIAERESKREMDRALARGRRR

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.524 kDa

MKGKAGGKAADAAEKVAASNRRARFDYDVEDTWEAGLVLTGSEVKSLREGNVNLSDAYAMPRGEELWLLNCRIGEYQQAAHFGHAPLRDRKLLMNRAEIDRVRGKVEQRGYTLVPLRIYFKQGWAKVELGLARGRSHEDRRGAIAERESKREMDRALARGRRR

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.785 kDa

MAKKKKAKNSNPVIASNRKARHDYKILDTFECGIVLLGTEIKSIREGKVSLTDSFATIDEGEAWIRNLNIPIYSRGSWTNHSPMRTRKLLLHRREIDSLMGKVRDGNKTLVPLSLYFKEGRLKVELGLAQGKQDYDKRQDIKRRTEEREVVRDLGRRVKGIHA

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.701 kDa

MVKKNSKKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPIRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTRG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.655 kDa

MVKKKSSKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPLRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTHG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.246 kDa

MSYKKKRCLKSSIICKNKKAYYNYFIEEVFQSGLVLMGWEVKSIRLGQVNIIESYINNDNLNEMYLYNSIVQPLHTSSNYVSCDSSRKRKLLLHKNEIQYLCNKKNKIGSTLVALSLFWEKSWCKLNFGLAKGKTKIDKRASEKQNEWKKEKLKILKKVKFQN

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.641 kDa

MVKKNSSKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPLRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTHG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.641 kDa

MVKKNSSKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPLRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTHG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.641 kDa

MVKKNSSKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPLRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTHG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.641 kDa

MVKKNSSKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPLRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTHG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.961 kDa

MAKKNAKKSKNPPATIARNKRANFDYKFEEKFEAGLSLMGWEVKSIRVGKVNLSESYVFLRDGEAYLFGCTITPLNTASTHVVCDPMRDRKLLLNRRELDKLQGLVERQGYSIVPISMYWRKNAWVKLEIGLGKGKKEHDKRDDTKEREWKIEKSRTMKHAAR

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.701 kDa

MVKKNSKKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPIRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTRG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.655 kDa

MVKKKSSKAAPATIARNKRATFEYRFEEKMEAGLSLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPLRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTHG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.701 kDa

MVKKNSKKAAPATIARNKRATFEYRFEEKMEAGISLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPIRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTRG

smpB

SsrA-binding protein

163 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.701 kDa

MVKKNSKKAAPATIARNKRATFEYRFEEKMEAGISLMGWEVKSIRMGKVNLSDCYVFLKNGEAFMHGCTIIPLNTASTHVVCDPIRLKKLLLSRKELDKLAGLVERQGYSIIPISMYWRKGAWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTRG

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.336 kDa

MLQKKKYQKKSSKIIINKKAYYNYFIEKVFQSGLVLEGWEIKSIRSGKVNISESYIINDRNEMYLCNCLIEPLQMSSNRFSCDPTRKKKLLLHKNEIDFLSLKKKNTGYTMVSLSLFWKKSWCKLEFGLAKGKTAQDKRINLKKREWEQEKLKILKKTKETY

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.588 kDa

MAKKKSKSSNSNTIALNKKARHNYSLTDKFEGGMSLQGWEIKSIRSGKVNISDCYVHIKDREAYLLGAEISPLNAASSHVVCDPNRDRKLLLNRRELDKIIAAVERDGYSLIATAMYWKACWVKLEFYLGKGKKDHDKRSDIKDREWAVDKGRLMKNKNLDR

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.121 kDa

MAETKSGKSGLISHGVAAQNRKARFDYTIKETVEAGLVLKGPEVKSLRHGRATLSEAWAGERDGEMFLFNAYIPEYQGGVLSRFEPRSPRKLLLKRKQINHLLGAVQKQGQTVVPLQIHFNERGMAKVLLGVAEGRNKADKRAAIASRDWQRDKARLMREKG

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

17.903 kDa

MPKEKARPGETLIARNKRAGFNYDLGDRFEAGIVLKGSEVKMLRAGKADLTDSFCTVLRGEVFLHGVSIAAMASAAFGHVPKGARKLLLHRREIERIDLSIAREGMTAVATRLYFKSGLAKVEIALARGKKSHDKRETIKEQDAEREMRAVVVHGQRGYGRA

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.405 kDa

MTSGGKSKGVGSEPGVRVIAENRRARFDYTVDEKVEAGLALTGSEVKSLRDGIANLSDAYALPKGDELFLLNANIGSYKAASFFDHLPTRGRKLLMHRGEIDRWTAKVRERGYSIIPLVLYFRNGRAKVELGLCRGKTHEDRRHDIKERETKREMDRAMRRR

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.604 kDa

MSKKNSKNKAGSNTIALNRSARHEYFIEEKIEAGLSLQGWEVKSLRAGKANISEAYVIFRDGEAYLFGSSFLPLQAASSHVVCDPTRTRKLLLSRRELDKLESLIARQGYTVVPLALYWKQCWVKVEIGLVKGKKEHDKREDTKAREWDREKARIMKNKHRG

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.561 kDa

MSKKNSKNKAGSSTIALNRTARHEYFIEERVEAGLSLQGWEVKSLRAGKANISEAYVIFMQGEAFLFGSTFLPLNAASSHVVCDPTRTRKLLLSRHELDKLESLTARQGYTIVPLALYWKECWVKVEIGLVKGKKEHDKREDTKAREWDREKARIMKNKHRG

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.336 kDa

MLQKKKYQKKSSKIIINKKAYYNYFIEKVFQSGLVLEGWEIKSIRSGKVNISESYIINDRNEMYLCNCLIEPLQMSSNRFSCDPTRKKKLLLHKNEIDFLSLKKKNTGYTMVSLSLFWKKSWCKLEFGLAKGKTAQDKRINLKKREWEQEKLKILKKTKETY

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

19.336 kDa

MLQKKKYQKKSSKIIINKKAYYNYFIEKVFQSGLVLEGWEIKSIRSGKVNISESYIINDRNEMYLCNCLIEPLQMSSNRFSCDPTRKKKLLLHKNEIDFLSLKKKNTGYTMVSLSLFWKKSWCKLEFGLAKGKTAQDKRINLKKREWEQEKLKILKKTKETY

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.643 kDa

MVKKKSANASASIARNKRATFEYRIEDKIEAGLQLMGWEVKSIRMGKVNLSDCYVYIKEGEAFMHGCTIQPLNTASTHVICDPIRTKKLLLKRSEIDKLAGLIERQGYTLVPLSMYWRKGAWVKVEIGLGKGKKDHDKREDTKEREWKIEKARVMKKDKENA

smpB

SsrA-binding protein

162 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.613 kDa

MAQVKSSSKSDPNYKVVAENRRARFDYAIESDVECGIILEGSEVKSLREGGANIAESYAAVEDGELWLVNSYIAPYKQAKTFQHEERRRRKLLISRKQLSDFWNATQRKGMTLVPLVLYFNHRGMAKIKIGVAKGKKLHDKRETAAKRDWSRQKSRLMKDHG

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.858 kDa

MKNQTPCRVSKITTITQNKRVRYEYFIEQEFEAGISLLGWEVKSLRAGIVHINDSYILLKDSEAFLLGATLRPLIVASSHILYSPMRSRKLLLRRRELDTLLGKVHRKGYTIVPISLYWRNSLAKIQLGIAKGKKQYDKRHCIKEREWLLNKARITKLVHR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.637 kDa

MTKKKTNTKAGSNTIALNKKARHEYFIEDEFEAGMELQGWEVKSLRQGKANIAESYVYIKDGEAFISGMTIIPLQQASTHVVANPTRIRKLLLSRRELDNLFGRINREGMTLTALSLYWSRSWVKIKIGVAKGKKLHDKREDLKEKEWQRQKDRVMKSALR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.401 kDa

MVKKKSKQKAGSNTIALNKKARHEYFIDDEIEAGMELQGWEVKALRQGKANIAESYVFMRDGEAFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREGMTLAALSLYWSRSWVKIKIGVAKGKKLHDKRTDLKEKDWAREKARVMKSSLR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.637 kDa

MTKKKTNTKAGSNTIALNKKARHEYFIEDEFEAGMELQGWEVKSLRQGKANIAESYVYIKDGEAFISGMTIIPLQQASTHVVANPTRIRKLLLSRRELDNLFGRINREGMTLTALSLYWSRSWVKIKIGVAKGKKLHDKREDLKEKEWQRQKDRVMKSALR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.637 kDa

MTKKKTNTKAGSNTIALNKKARHEYFIEDEFEAGMELQGWEVKSLRQGKANIAESYVYIKDGEAFISGMTIIPLQQASTHVVANPTRIRKLLLSRRELDNLFGRINREGMTLTALSLYWSRSWVKIKIGVAKGKKLHDKREDLKEKEWQRQKDRVMKSALR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.399 kDa

MAKKKSKQKAGSNTIALNKKARHEYFIEDEIEAGLELQGWEVKALRQGKANISESYVFMRDGEAFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREGMTLTALSLYWSRSWVKIKIGVAKGKKLHDKRTDLKEKDWAREKARVMKSALR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.426 kDa

MAKKNSKPKAGSNTIALNKKARHEYFIEDEIEAGMELQGWEVKALRQGKANISESYVFMRDGEAFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREGMTLAALSLYWARSWVKIKIGVAKGKKLHDKRDDIKDRDWQRQKARVMKSSLR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.426 kDa

MAKKNSKPKAGSNTIALNKKARHEYFIEDEIEAGMELQGWEVKALRQGKANISESYVFMRDGEAFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREGMTLAALSLYWARSWVKIKIGVAKGKKLHDKRDDIKDRDWQRQKARVMKSSLR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.367 kDa

MAKKKSKDKAGSNTIAMNKQARHEYFIDDEIEAGIELQGWEVKSLRSGKVNIAESYVYVRDGEIFISGMTITPLQAASTHVVANPTRIRKLLMSRKEIDNLIGRVNREGMTLVATTMYWVRSWAKIKVGVAKGKKLHDKRTDSKEKDWNRDKARIMKSSLR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.366 kDa

MAKKKSKDKAGSNTIAMNKQARHEYFIEDEIEAGVELQGWEVKSLRSGKVNIAESYVYVRDGEIFISGMNITPLQAASTHVVANPTRVRKLLMSRKEIDNLIGRVNREGMTLVATTMYWVRSWAKIKVGVAKGKKLHDKRTDSKEKDWNRDKARIMKSSLR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.433 kDa

MTKKKVKPNSNTIALNKRARHDYFIEDEIEAGLELQGWEVKSMRAGKANISDSYVIFKNGEAFLFGASIQPLNVASTHIVCDPTRTRKLLLNKRELASLFGKANRDGFTIVALSLYWKSAWAKVKIGLAKGKKQQDKRDDIKEREWKVTKDRIMKNAHRRS

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.482 kDa

MVRPQSAAEFDKKKVVAENRRARFDYAIEQVFEAGIALQGTEVKSLRFGEGTIAESYAEVNGGEVWLINANIPEFSHGNRFNHEPKRPRKLLLNWREINKLHAGVARQGMTLVPLSVYFNSRGRAKVELALAKGKKAHDKRESIKERDWKRDKQRLLKDRG

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.287 kDa

MTKKSASSNNKVVATNRKARHNYTILDTYEAGIVLMGTEVKSLREGQASLADAFATVDDGEIWLRNVHIAEYHHGTWTNHAPRRNRKLLLHRKQIDNLIGKIRDGNLTLVPLSIYFTDGKVKVELALARGKQAHDKRQDLARRDAQREVIRELGRRAKGKI

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.746 kDa

MAKKNSKTKNNDNTIARNKRASHDYHLEERFEAGLELQGWEVKSLRAGKANIADSYIFLKNGEAWLLGATFPPLLVASSHVVCDPMRYRKLLLNRRELDNLVGKVERQGYSIIPISLYWKHAWVKISFALAKGKQEHDKRADVKDREWKVDKERMMKHSVR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.893 kDa

MTKNKPSTAEKTRLICQNKKAYHDYDILEKFEAGIVLLGTEVKSLREGRANLKDSYARVRKGEVFLQGLHISPYTHASYNNHEPERVRKLLLHAHEIKRLTGKTQERGLALIPLKLYFSKGKVKVELALAQGKKLYDKRESIKRKEENRELDRLRKRRRQE

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.381 kDa

MAKKKSKDKAGSNTIAMNKQARHEYFIDDEIEAGIELQGWEVKSLRSGKVNIAESYVYVRDGEIFISGMTITPLQAASTHVIANPTRIRKLLMSRKEIDNLIGRVNREGMTLVATTMYWVRSWAKIKVGVAKGKKLHDKRTDSKEKDWNRDKARIMKSSLR

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.683 kDa

MAAKATSEKGFKTITDNRRARHEYHVIETYEAGIALSGTEVKSLRAGKANLQDAFARVENGEMMLYNLHISPYEQGNRFNHEPKRTRRLLMHKQEILRLYGKVREKGLALIPLKVYFNPRGKVKVQLALAQGKKSYDKRHDIAARDAKRDMDRAMRERQKM

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.907 kDa

MAKKNKKISLNTIAFNKKARHVYFIEQTLEAGLSLEGWEVKSLRDSKVQIKESYVILRSNEIFLYGAHISPLKSVSTHVNSDPIRTRKLLLNRLEINRIKEKINQKGATIVALKLYWIRGMVKLEIGLAKGKKSYDKRQDNKLRDWQRDKQRTLKQINYRL

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.433 kDa

MTKKKVKPNSNTIALNKRARHDYFIEDEIEAGLELQGWEVKSMRAGKANISDSYVIFKNGEAFLFGASIQPLNVASTHIVCDPTRTRKLLLNKRELASLFGKANRDGFTIVALSLYWKSAWAKVKIGLAKGKKQQDKRDDIKEREWKVTKDRIMKNAHRRS

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.415 kDa

MTKKKVKPNSNTIALNKRARHDYFIEDEIEAGLELQGWEVKSIRAGKANISDSYVIFKNGEAFLFGASIQPLNVASTHIVCDPTRTRKLLLNKRELASLFGKANRDGFTIVALSLYWKSAWAKVKIGLAKGKKQQDKRDDIKEREWKVTKDRIMKNAHRRS

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.433 kDa

MTKKKVKPNSNTIALNKRARHDYFIEDEIEAGLELQGWEVKSMRAGKANISDSYVIFKNGEAFLFGASIQPLNVASTHIVCDPTRTRKLLLNKRELASLFGKANRDGFTIVALSLYWKSAWAKVKIGLAKGKKQQDKRDDIKEREWKVTKDRIMKNAHRRS

smpB

SsrA-binding protein

161 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.387 kDa

MATKKNEQIKGRTDGLVAENRRSRREYSVEDTLEAGIMLVGSEVKSLREGRANIAESYASVEQGELWLINAEIQTYGGANRFNHEPRRKRKLLVSRRELSKLSQEVERAGRTIVPLKLYFNDKGRAKLLIGVATGRKAHDKREHEAKRDWARDKARIMKAG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.483 kDa

MTATKHKHPGVVAENRKARHDYDIEETIEAGIVLSGSEIKSVRAGRVNLRGSFARVIDDEVFLYDAHIAPYEQSGKYFNHDPMRPRKLLLHRREINRLNGLVRMKGMTLVPLKVYFKGRRAKVELGVARGKKIYDKREDIARRDAARDIDRALKRARHDL

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.285 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNSHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to tmRNA RNA (also known as SsrA or 10Sa RNA, 363 nucleotides in this organism), required for stable binding of tmRNA to ribosomes (PubMed:10393194, PubMed:11904185, PubMed:11917023). tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB (Probable). tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. Able to recruit charged tmRNA to ribosomes (PubMed:15069072). Does not play a role in transcription, processing or Ala-aminoacylation of tmRNA (PubMed:10393194). Other studies have shown it stimulates aminoacylation of tmRNA (PubMed:11917023, PubMed:11904185). May protect tmRNA from degradation (PubMed:11917023). Binds to tmRNA that cannot be aminoacylated (tmRNA G3A), does not bind to tmRNA mutations near the tRNA-like termini (tmRNA G19C, A334U); other tmRNA mutations that block trans-translation still bind SmpB (PubMed:11917023). With tmRNA may play a role in bacterial persistence (PubMed:23812681). During trans-translation Ala-aminoacylated transfer-messenger RNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA, the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.219 kDa

MTKKKAYKPGSATIAMNKRARHDYFIEEEFEAGLSLQGWEVKSLRAGKANISESYILLQNGEAFLFGATFTPLNVASSHVVCDPTRTRKLLLKERELASLFGSANRDGYTIVPLSLYWKNAWAKLKIGVAKGKKEHDKRDDIKTREWKQDKARIMKNANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.267 kDa

MTKKKVKVGTNTIALNKRARHDYFIEDEMEAGLELQGWEVKSMRAGKANISDSYIIFKQGEAYLFGATIQPLNVASTHIVCDPTRTRKLLLKQKELASLFGKANRDGYTIVALSLYWKGAWAKLKIGLAKGKKQHDKREDIKEREWKVTKDRIMKNARLG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAYKPGSATIAQNKRARHEYSIEEEFEAGLVLQGWEVKSLRAGKANLSDSYVTFMNGEAYLFGATITPLNVASSHVVCDPIRTRKLLLNKREMDSLFGRVSRDGYTVVALSMYWKNAWSKVKIGVAKGKKDHDKRDDIKEREWKLDKARIMKNANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.311 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANLSDSYVTFMNGEAYLFGATITPLNVASSHVVCDPIRTRKLLLNKRELESLFGRVSREGYTVVALSMYWKNAWSKVKIGVAKGKKDHDKRDDIKEREWKLDKARIMKNANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.224 kDa

MTKKKAHKPGSATIAMNRRARHEYFIEEEFEAGLSLQGWEVKSLRAGKANISDSYVLLKDGDAYLFGATITPLNVASSHVVCDPMRSRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVRIGVAKGKKAHDKRSDIKEREWKLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.274 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAYLFGANFQPLNVASTHVVCDPTRTRKLLLNQRELDNLYGRINRDGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.544 kDa

MPREQGVRVVARNRRATHDYTIGDTWEAGLVLQGTEVKSLRAGKATLTDAFAQVDERGEVWMYNLHIPEYAFGTWRNHDVMRKRKLLLNKREIAKLSREADGPGKTIVPLQLYFKDGYAKVEIAVGTGKRDWDKRQAIRERDAKREAQRALANRVRNRKR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.239 kDa

MTKKKAHKPGSATIALNKRARHEYFIEDEYEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAFLFGANFTPMAVASTHYVCDPTRTRKLLLNQRELDTLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRTDLKDREWALDKARIMKHAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.239 kDa

MTKKKAHKPGSATIALNKRARHEYFIEDEYEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAFLFGANFTPMAVASTHYVCDPTRTRKLLLNQRELDTLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRTDLKDREWALDKARIMKHAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.252 kDa

MARAGNSLISHGRVAENRRARHDYSIEETIEAGLILVGTEVKSLRTGRANIADSYAGPKSGELYLYNAYIPDWTQAVKAFAHEPRQPRKLLVHRREARRLISAINKDGMTLVPLYLYFNDRGFAKVQLGLAKGRKAHDKRQAIKEREWNRDKARVLRDKG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.446 kDa

MRAVSKKKKTPENVIALNRKARFEFHIEETMEAGLALEGWEVKSLRAGRVNLQEAYVLIRRGEAWLIGCTITPLPTASTHIKPDPTRTRRLLLHKKEIARLTGAADREGYTVVPLDLHWKRGKAKLSIGLAKGKKKHDKRADQKEQDWQRQKQRLMKHKV

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.657 kDa

MMAEKKKKELPRKVVADNRRARFDYDIGEVFEAGIALKGTEVKALRTGKATIHESYAGGKNGELWLFNSYVPEYLEANRFNHEPRRPRKLLMHKRQIHKLTVAVEREGMTVVPLKIYFNEQGRAKVEVALAKGRKAHDKREAVKERDWNRDKARLMRDRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.098 kDa

MAKKPKVPSNTIALNKRARHEYFIEDEIEAGLALQGWEVKSLRAGKANIGDSYVTFRHGEAFLFGATITPLNMASTHIVADPTRTRKLLLNQRELDSLFGKVNRDGMTVVALSLYWKNAWAKVKIGLAKGKKLHDKREDIKDREWHVTKQRIMKNAGRGS

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.409 kDa

MTVMKEKGRKVIATNRRARHNYTILDTYEAGIVLVGTEVKSLREGKASLVDAFATVDNGEVWLRGLHIPEFSHGTWTNHSPRRVRKLLLHKREIERLVGKSREGNQTLVPLSMYFSDGKVKVELALARGKQDYDKRQDLARRTAEREVTRELGRRVKGMR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.404 kDa

MARPVHPEFDKKKVVAENRRARFEYFIEETYEAGICLTGTEVKSLRFGEGSIAESYAEVKNGEVWLVNSNVPEFSHGNRFNHVPKRPRKLLLKERQIAKFTGAVERKGMTLVPLSIYFNSRGRAKVELALAKGKNAADKRTTIKERDWKREKARIMKDHG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.415 kDa

MTKKKEHKPGSATIAQNKRARHEYFIEQEFEAGLSLQGWEVKSLRAGKANIGDSYVLLKDGEAYLFGATFQPLTVASSHVVCDPMRTRKLLLNKRELDSLFGRVNREGYTVVALSLYWKNAWVKVKIGVAKGKKEYDKRTDIKEREWQLDKSRIMKHASR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.471 kDa

MARPRPATFDKVKTVAENRRARFDYFIEQTYEAGLVLTGTEVKSLRFGEGSIAEAYAEVKDEXVWLVNANIPEFSHGNRFNHEAKRPRKLLLHEREINKLHGAVAREGMTLVPLSVYFNGKGRAKVELALAKGKKTHDKRETIKERDWKREQSRILRDRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.739 kDa

MARPRPAEFEKKKVVAENRRARFDYFLEQFFEAGIALTGTEVKSLRFGEGSIAESYAEVKDDQVWLVNSNVPEFSHGNRFNHEPKRPRKLLLHAREIDKMRNGVSREGMTLIPLSIYFNGRGRAKVELALAKGKKLHDKRDTEKERDWKREQQRLLRDRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.26 kDa

MTKKKSHKPGSATIALNKRARHEYFIEDEIEAGLSLQGWEVKSLRAGKANISDSYVIMRDGEAYLFGATITPLNVASTHVVCDPTRTRKLLLKQRELANLYGQINRDGYTVVALSLYWKNAWCKIKIGVAKGKKDHDKRDTIKDREWKLDKARIMKNANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.331 kDa

MAKLKKNPTGTIAQNKKARHDYFIEHKFEAGLVLAGWEVKSLRATKVQLVDSYVLLKDGEAWLMGCHITPLKTASTHVIADPTRTRKLLLNKRELEKLTSSVQQKGYACVALSVYWKEHLIKCEIALGKGKKEYDKRHTERERDSDRELQRAVRSKGKDD

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.199 kDa

MAKQKKHPQGNIAQNKKALHDYFIEQKFEAGLALSGWEVKSLRAGKAQLVDSYVLLKDGEAWLMGSHITPLKTASTHVIADPTRTRKLLLHKRELGRLFGSVQQKGYACVALSLYWKKHLIKCEIALAKGKKEYDKRDTEKARDSDREIQRAIRSKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.199 kDa

MAKQKKHPQGNIAQNKKALHDYFIEQKFEAGLALSGWEVKSLRAGKAQLVDSYVLLKDGEAWLMGSHITPLKTASTHVIADPTRTRKLLLHKRELGRLFGSVQQKGYACVALSLYWKKHLIKCEIALAKGKKEYDKRDTEKARDSDREIQRAIRSKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.483 kDa

MTATKHKHPGVVAENRKARHDYDIEETIEAGIVLSGSEIKSVRAGRVNLRGSFARVIDDEVFLYDAHIAPYEQSGKYFNHDPMRPRKLLLHRREINRLNGLVRMKGMTLVPLKVYFKGRRAKVELGVARGKKIYDKREDIARRDAARDIDRALKRARHDL

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.253 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAYLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.289 kDa

MTKKKVHKPGSATIALNKRARHEYFIEEEFEAGLSLQGWEVKSLRAGKANISDSYVILIDGEAFLFGANFTPLAVASSHYVCDPIRTRKLLLNQRELESLFGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKDREWQVDKARIMKHAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.376 kDa

MTKKKSHKPGSATIAMNKRARHEYFIEEEFETGLSLQGWEVKSLRAGKANISDSYILLRDGEAFLFGSTFQPLSVASSHIVCDPTRSRKLLLKKRELDTLIGKANRDGYTIVALSMYWKNAWAKLKIGLAKGKKEHDKRDDIKDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.5 kDa

MARPKPETFDKQKTVAENRRARFDYAVEDKFEAGIALQGTEVKALRAGEASIAESYAEVRDGEAWLINANIPEYSHGNRLNHQPRRPRKLLLHNREIERLLGAVERKGMTLVPLSIYFNSRGRAKVELALAKGRQAQDKREYIKDRDWKRDKARIMRDKG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.23 kDa

MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.23 kDa

MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.23 kDa

MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.344 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRAGKAHLTDSYVLLKDGEAWLFGSHITPLTTASTHVIADPIRTRKLLLNKRELERLEAAVAQKGYTCVAMSLYWSKHLIKCEIALGKGKKEFDKRDTVRERDSNRELQRTMRNKGKEE

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.334 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHRFEAGMVLAGWEVKSLRAGKAQLVDSYVLLKDGEAWLLGSHFTPLTTASTHVIADPTRSRKLLLNQRELEKLFAAVQQKGYACVCLSLYWSKHLVKCEIALGKGKKEYDKRHTERERDSDRELQRAVRTKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.319 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHRFEAGLVLAGWEVKSLRASKLQLVDSYVLLKDGEAWLLGSHITPLTTASTHVIADPVRTRKLLLNARELEKLAAAVQQKGYACICLSWYWSKHLVKCEIALGKGKKEYDKRDTERERDSNRELHRAVRNKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MAKQKKHPQGTIALNKKALHDYFVEQKFEAGVALAGWEVKSLRAGKAQLVDSYVLLKDDEAWLMGAHITPLKTASTHVIADPIRTRKLLLHKRELDKLFGAVQQKGYTCVALSLYWKQHLVKCEIALAKGKKDFDKRHVEKERDANREVQRAMRSKGKDD

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.254 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRAGKAHLTDSYVLLKDGEAWLFGSHITPLTTASTHVIADPTRTRKLLLNKRELERVEAAVAQKGYTCVALALYWSKHLIKCEIALGKGKKEFDKRDTMRERDSNRELQRAVRNKGKEE

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.314 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHKFEAGLVLAGWEVKSLRASKLQLVDSYVLLKDGEAWLLGSHITPLMTASTHVIADPVRTRKLLLNRRELDKLAAAVQQKGYACVCLSWYWSKHMVKCEIALGKGKKEYDKRDTERERDAGRELQRAVRNKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.266 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRAGKAHLTDSYVLLKDGEAWLFGSHITPLTTASTHVIADPIRTRKLLLNKRELERLEAAVAQKGYTCVALALYWSKHLIKCEIALGKGKKEFDKRDTMRERDSNRELQRAVRNKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.254 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRAGKAHLTDSYVLLKDGEAWLFGSHITPLTTASTHVIADPTRTRKLLLNKRELERVEAAVAQKGYTCVALALYWSKHLIKCEIALGKGKKEFDKRDTMRERDSNRELQRAVRNKGKEE

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.206 kDa

MAKQKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRAGKAHLTDSYVLLKDGEAWLFGSHITPLTTASTHVIADPIRSRKLLLNKRELERVEAAVAQKGYTCVALALYWSKHLIKCEIALGKGKKEFDKRDTVRERDSNRELQRAVRNKGKED

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.397 kDa

MAKLKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRATKVQLVDSYVLLKDGEAWLMGCHITPLKTASTHVIADPTRTRKLLLNQRELEKLTSSVQQKGYACVALSIYWKQHLIKCEIALGKGKKEYDKRHTERERDSDRELQRAVRTKGKDD

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.356 kDa

MAKLKKHPTGTIAQNKKARHDYFIEHKFEAGLVLSGWEVKSLRATKVQLVDSYVLLKDGEAWLMGCHITPLKTASTHVIADPTRTRKLLLNKRELEKLTSSVQQKGYACVALSVYWKEHLVKCEIALGKGKKEYDKRHTERERDSDRELQRAVRSKGKDD

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.109 kDa

MAKQKKQSPGTIALNKKALHDYFIEQKFEAGLVLAGWEVKSLRAGKAQLVDSYVLLKDGEAWLMGAHITPLTSASTHVIADPTRTRKLLLNKRELGKLFGAVQQKGYACVALSLYWKKHMIKCEIALAKGKKEFDKRHTEKERDSDREIQRAMRTKGKDD

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.656 kDa

MARKKKQDKGQGPKTIAQNRRARHDYHIEDTYEAGLVLTGTEVKSLRAGRASLVDGFAQIKNGEVWLHNVHIPEYTMGTWTNHAPRRPRKLLLHREEIAKLDAKTREAGRTLVPLSLYFRNGRAKVEIALARGKREYDKRHDIAEREAKREMERALRRRR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.202 kDa

MAKKKNKAGDNTIALNKRARHDYFIEEEIEAGLSLQGWEVKSMRAGKANISDSYVIFNNGEAFLFGATIQPLSVASTHVVCDPTRTRKLLLNERELASLFGKANRDGYTLVALSLYWKNAWAKLKIGLAKGKKQHDKREDIKDREWKVQKDRIMKNAHRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.627 kDa

MAPKGSQRVVNKIVAENRKARFNYEIIDTYEAGLVLTGTEVKSLREGKANIAESYASDEGDEIWLINSHLPEYLQANRFNHEPRRRRKLLLNKREINRLRAGINRDGMTLVPLKVYFNEKGRAKLELALAKGKKLHDKRETEKERDWNRQKSRLLKGNSQ

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.72 kDa

MAKPKTPEEKNYKVIAENRRARREYAIEEDLEVGIVLEGSEVKSLREGGSNIAESYATVDDGELWLVNSYIAPYAQAKTWKHEERRRRKLLVSRRELSRLWNATQRQGMTLVPLVMYFNHRGLVKLKIGVAKGKKLADKRQTDAKRDWNRQKQRLLKQNL

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.269 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.309 kDa

MTKKKVKPGSNTIALNKRARHDYFIEEELEAGLSLQGWEVKSMRAGKANISDSYIIFRDGEAYLFGATIQPLTVASTHVVCDPTRTRKLLLNQRELASLFGKANRDGYTIVALSLYWKNAWAKIKIGLAKGKQQHDKRNDIKDREWKMQKERIMKNANRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.129 kDa

MSKKKANAPTSNTIALNKKAKHEYHIEERFEAGLALLGWEVKSLRAGKAQLVDAYVLLKDGEAWLLGSHITPLNTASTHVIADPTRTRKLLLHAKEIAKIVGQVNQAGYTCIPLALYWKKNKVKCEIALVKGKKLFDKRATEKERDWNRQKQRIMREANT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.255 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKHAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.429 kDa

MSKNKTKKGGDSTIALNKKARHDYFIEDKYEAGLALQGWEVKSLRAGKAHIGDSYVLLQNGEAFLFGATITPLNVASTHVVCDPTRIRKLLLKKSELERLIGLVERQSYTLIPLSMYWSRAWVKVEIGLAKGKKEHDKREDLKEREWQRDKERMMKNKGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.072 kDa

MTKKKAKVASNTIALNKRARHDYFIEDEIEAGLSLQGWEVKSMRAGKASIGDSYIIFKHGEAYLFGATIQPLSVASTHIVCDPTRTRKLLLNQKELASLFGKANRDGFTIVALSLYWKGPWAKVKIGLAKGKKLHDKREDIKDREWKVTKDRIMKNAQRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.301 kDa

MSQAKNKNTGSTIALNKKARFDYHIVEKFEAGLALTGWEVKSLRAGKCQLVDSYVLLKDSEAWLLGAHITPLKEASTHVIADPTRTRKLLLHRRELNKLIGAVSQTGHTCVPLALYWKGNKVKCEIALVKGKKDFDKRETEKERDWNRQKQRVIRDHVKQ

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.398 kDa

MIKKKTYKPGSATIAQNKRARHEYFIEEEFEAGVVLQGWEVKALRAGKVNISDSYVLLKKGEAFLLGATITPLNVASTHTVCESMRTRKLLLKQREIDSLFGRINREGYTVVALSMYWKNAWSKIKIAVAKGKKTHDKRDSIKDRDWKINKDRIMKNANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.072 kDa

MTKKKAKVASNTIALNKRARHDYFIEDEIEAGLSLQGWEVKSMRAGKASIGDSYIIFKHGEAYLFGATIQPLSVASTHIVCDPTRTRKLLLNQKELASLFGKANRDGFTIVALSLYWKGPWAKVKIGLAKGKKLHDKREDIKDREWKVTKDRIMKNAQRG

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.23 kDa

MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.23 kDa

MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.23 kDa

MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.205 kDa

MARNPRGGKQIVATNRKARHDYAIIELFEAGVALLGTEVKSLREGHASLADAFATVDSGEVWLRNMHIPEYQHGSWTNHDPRRNRKLLLHRRQIDTLVGKIRDGNLALVPLSLYFAEGKVKVELALARGKKLHDKRQDMARRDAQREVIRELGRRAKGML

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.205 kDa

MARNPRGGKQIVATNRKARHDYAIIELFEAGVALLGTEVKSLREGHASLADAFATVDSGEVWLRNMHIPEYQHGSWTNHDPRRNRKLLLHRRQIDTLVGKIRDGNLALVPLSLYFAEGKVKVELALARGKKLHDKRQDMARRDAQREVIRELGRRAKGML

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.232 kDa

MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.181 kDa

MTKKKAHKPGSATIAQNKRARFEYAIEEEFEAGLSLQGWEVKSLRAGKANISDSYVTFRDGEAYLFGATVSPLNVASSHVVCDPTRTRKLLLKKRELDSLLGRVNRDGYTVVALSMYWKNAWAKIKIGVAKGKKEHDKRDDIKDREWQTAKSRIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.411 kDa

MVKKNSKKAAQPATIARNKRATFEYKFDEKFEAGLSLMGWEVKSIRAGKINISESYVMLKNGEAFLHHCHITPLHAASTHVVCDPTRPRKLLLNRRELDRLAGLVERQGYAIVPISMYWRKGAWVKVEIGLGKGKKAHDKRDDIKQRDWDIEKARVMKNK

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.329 kDa

MANKKEEPGHSPLVNKKAKFNFELVSFIEAGIVLSGSEVKSLREKKGNLTDAFAKIKNGEVFLENFSITPYKNGGYVNHPEIRPRKLLLHKKEIEKLERQVKEKGLVLVATKVYFKNNLRVKVEIAVGKPKKIHDKRDDMQKKDAQQEIARALKSSNRYE

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.329 kDa

MANKKEEPGHSPLVNKKAKFNFELVSFIEAGIVLSGSEVKSLREKKGNLTDAFAKIKNGEVFLENFSITPYKNGGYVNHPEIRPRKLLLHKKEIEKLERQVKEKGLVLVATKVYFKNNLRVKVEIAVGKPKKIHDKRDDMQKKDAQQEIARALKSSNRYE

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.284 kDa

MVKKKEESGHSPLVNKKAKFNFELISFLEAGIVLSGSEVKSLRDKKGNLTDAFAKIKNGEVFLENFSIAPYKNGGYANHPEIRPRKLLLHKKEIEKLERQVKEKGLVLVATKVYFKNNLRVKVEIAVGKPKKLHDKRDDLQKKDAQQEIARALKSSNRYQ

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.284 kDa

MVKKKEESGHSPLVNKKAKFNFELISFIEAGIVLSGSEVKSLRDKKGNLTDAFAKIKNGEVFLENFSIAPYKNGGYANHPEIRPRKLLLHKKEIEKLERQVKEKGLVLVATKVYFKNNLRVKVEIAVGKPKKLHDKRDDLQKKDAQQEIARALKSSNRYQ

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.292 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLSLQGWEVKSLRAGKANISDSYVTFRNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLIGKVNRDGFTVVALSVYWKNAWVKVKIGVAKGKKDHDKRDDIKDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.407 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.407 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.407 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.407 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.407 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.407 kDa

MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHANR

smpB

SsrA-binding protein

160 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.49 kDa

MAAFRPPQFKKSKILAENRRARYEYAFEDFYEAGLALTGTEVKSLRFGQGSIAESYAEVKNGEVTLINANIPEFSHGNRFNHEPKRPRKLLLHEREIRKMQTAVSREGMTVIPVSLYFNNKGKAKLELAIARGKKTHDKRATIKERDWKRDQARLLRDKG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.322 kDa

MAKEQGTKPIAQNKKARHDYAIEDKYEAGLVLTGTEVKSLREGRASLAESFITIDRRGEMWLEGANIPEYLNGTWNNHAPKRKRKLLLHAAQIDKLARQTQAKGFTIIPLSLYFKDGRVKVEIALARGKKEFDKRQSLREEQDKREALRAMRYANKQVR

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.688 kDa

MAKKNQKSGSNTIALNKKAKFDYELHERFEAGLALTGWEVKSLRAGKGNITDCYVIFKNNEAWLQACQIQPLLSASTHFVTDPFRNRKLLLNRREINRLQEAVEQKGYTVVPIALYWKAHMVKCEIAIAKGKQLHDKRQTEKERDWEREKQRLFQRDQR

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.381 kDa

MAKEKGRKLIAQNKKARHDYQILDTYEAGLVLSGTEVKSLRQGRASLADGFVQLDGHEAWLHNVHVPEYSQGTWTNHSARRKRKLLLHRVEIDKLESKSQETGHTIVPLALYFKDGRAKVEIALARGKKEYDKRQTLREKQDRREAERTISAIKRKQRA

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.389 kDa

MNKQISKKPAQRTIALNKKALHDYYVEQRFEAGLVLEGWEVKSIRAGRVQLRDSYVVFKSGEAWLIGAHLSPLPNVAEYMKADPQSSRKLLLNKREIGKLFGAVQKQGLTVVPLDLHWHKNHVKVEIALAKGKKTHDKRETIKRREWEREKHRVLKSHG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.429 kDa

MNKQISKKPAQRTIALNKKALHDYYVEQRFEAGLVLEGWEVKSIRAGRVQLRDSYVVFKGGEAWLIGAHLSPLPNVAEYMKADPQRSRKLLLNKREIGKLFGAVQKQGLTVVPLDLHWHKNHVKVEIALAKGKKTHDKRETIKRREWEREKHRVLKSHG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.429 kDa

MNKQISKKPAQRTIALNKKALHDYYVEQRFEAGLVLEGWEVKSIRAGRVQLRDSYVVFKGGEAWLIGAHLSPLPNVAEYMKADPQRSRKLLLNKREIGKLFGAVQKQGLTVVPLDLHWHKNHVKVEIALAKGKKTHDKRETIKRREWEREKHRVLKSHG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.369 kDa

MNKQISKKPAQRTIALNKKALHDYYVEQRFEAGLVLEGWEVKSIRAGRVQLRDSYVVFKGGEAWLIGAHLSPLPNVAEYMKADPQRSRKLLLNKPEIGKLFGAVQKQGLTVVPLDLHWHKNHVKVEIALAKGKKTHDKRETIKRREWEREKHRVLKSHG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.457 kDa

MNKQISKKPAQRTIALNKKALHDYYVEQRFEAGLVLEGWEVKSIRAGRVQLRDSYVVFKGGEAWLIGAHLSPLPNVAEYMKADPQRSRKLLLNKREIGKLFGAVQKQGLTVVPLDLHWHKNHVKVEIVLAKGKKTHDKRETIKRREWEREKHRVLKSHG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.444 kDa

MSKKKPQQSSNTIARNKKARHEYFLEDKFEAGVSLQGWEIKSIRAGKVNISDSYVIIKNGEAYLLGAEIQPLNQASSHVYCEPDRSRKLLLKRRELDKLIGASEREGYSIVATTIYWKGPWAKLEIFLAQGKKSHDKRDTIKERDWQRQKARIMKHSVR

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.553 kDa

MAPKGSQRVVNKVVAENRKARFNYEIIDTYEAGLVLKGTEVKSLREGKANIAESYASDEDGEIWLINSYLPEYLQANRFNHEPRRRRKLLLSGREIHRLRSAVNREGMTLVPLKIYFNDRGRAKMELALAKGKKLHDKRESEKERDWNRQKSRLLKDNG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.553 kDa

MAPKGSQRVVNKVVAENRKARFNYEIIDTYEAGLVLKGTEVKSLREGKANIAESYASDEDGEIWLINSYLPEYLQANRFNHEPRRRRKLLLSGREIHRLRSAVNREGMTLVPLKIYFNDRGRAKMELALAKGKKLHDKRESEKERDWNRQKSRLLKDNG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.467 kDa

MNQVRKADPNNKTVAENRKARFSYEVLDTIEAGLVLTGTEVKSLRQGQANIQDSYASVEGGEIWLINSYLPEYLQANRFNHEPRRRRKLLLNKREMAKLSQSVDREGMTLVPLKIYFNDQGRAKLLLAVGRGKKLHDKRETEKQRDWSREKGRLLKERG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.512 kDa

MAPKGSQRVVNKVVAENRKARFNYEIIDTYEAGLVLMGTEVKSLREGKANIAESYASDEGGEIWLINSYLPEYLQANRFNHEPRRRRKLLLSGREIHRLRSAVNREGMTLIPLKIYFNDRGRAKMELALAKGKKLHDKRESEKERDWNRQKSRLLKDNG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.558 kDa

MAPKGSERTVKKVVAENRKARFNYEIVDTYEAGLVLTGTEVKSLREGKANIAESYATDEGGEIWLINSYLPEYLQANRFNHETRRRRKLLLSKREVNRLQGAVNREGMSLIPLRIYFNERGRVKLELALGKGKKLHDKRETSKERDWNRQKNRLLKERG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.459 kDa

MKKNKANKNTSGNIAQNKKARHDYFLEDKFEAGLELQGWEIKSIRAGKVNITDAYIIIQNAEAYLVGCRISPLNQASTHVVAAPERARKLLLKKREIDRLMGARDRQGYSIVATSMYWKKCWVKLEIHLAKGKHAHDKRDTLKDKDWQRQKERMMKHSV

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.192 kDa

MAKEQGRKLIAQNKKARHDYHIEDTYEAGLVLQGTEVKSLRQGRASLVDGFVDIDRGEAWLHGVHIPEYSQGTWTNHAARRKRKLLLNRDEIDKIERRVNEKGLTVVPLALYFKDGRAKVEIALAKGKKSWDKRAALAERQANRETEQAVGRRLKGMHD

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.577 kDa

MAQKGSERTIRKVVAENRKARFNYEIVDTYEAGLVLTGTEVKSLREGKANISESYATDEGGEIWLINSYLPEYLQANRFNHETRRRRKLLLSKREVNRLQGAVNREGMSLIPLKIYFNDRGRAKLELALGKGKKLHDKRETSKERDWNRQKNRLLKERG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.558 kDa

MAPKGSERTVKKVVAENRKARFNYEIVDTYEAGLVLTGTEVKSLREGKANIAESYATDEGGEIWLINSYLPEYLQANRFNHETRRRRKLLLSRREVNRLQGAVNREGMSLIPLRIYFNERGRAKLELALGKGKKLHDKRETSKERDWNRQKNRLLKERG

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.032 kDa

MAKQKKHPSGTIAQNKKALHDYFIEQRFEAGVALAGWEVKSLRAGKAQLVDSYVLLKDGEAWLLGSHITPLTTASTHVIADPVRTRKLLLHKRELGKLFGAVQQKGYACVALSMYWKKHLVKCEIALAKGKKDFDKRHTEKERDSDREIQRAMRHGKDD

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.

18.032 kDa

MAKQKKHPSGTIAQNKKALHDYFIEQRFEAGVALAGWEVKSLRAGKAQLVDSYVLLKDGEAWLLGSHITPLTTASTHVIADPVRTRKLLLHKRELGKLFGAVQQKGYACVALSMYWKKHLVKCEIALAKGKKDFDKRHTEKERDSDREIQRAMRHGKDD

smpB

SsrA-binding protein

159 amino acids

Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.

Belongs to the SmpB family.