sepF

Cell division protein SepF

280 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

31.495 kDa

MSTLHKFKAYFGMVPLEDYEDDYVDDRAPRASERGGARGPRPYSERAGYGADRYGEDRYSADRFGPERFGAERFGPDRFGADRFDEDADYPEPAYKSYKSGYPVARRDDYPEDAYGEDRYEAPRRPTRIDAAPSSGRFRAGGGAPMLRGATRGALAVDPEAEERRLEERMRPEPVVARRPGIFEDGGPLSKITTLRPRDYSEARIIGERFREGNPVIMDLVELSNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSAEERRRIAETGFYNQK

sepF

Cell division protein SepF

226 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.408 kDa

MGALRKAGVWLGLVEEDDERAYDDAGYDKGGYRESRYRSSRYSEDFGDEDDEDEEAAVPRSRRGDRSRLERAAARSGDVDHNVEGEQPERVERASVRSITRSAEPSESLTYHTRDNLALAPQPVRERVPADEEQRYQITTLHPTTYREARTIGEHFRDGVPVIINLTEMDEADARRLVDFAAGLAFGLRGTIERVTNRVFLLSPANVQVTAEDKAKIAEGGFFSLS

sepF

Cell division protein SepF

225 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.129 kDa

MSSLHKFKAYFGMVPLDDYEDEYLDEPEPARRPARPARDSGRDPYLDRDDRDFAEPAFSKAAYAPGRRDDLDDDFDRYDGPRHSSRVEPVAVRSARPSASGAVRGSTRGALAVDTRSERVESRRGPLFDEGGPLSKITTLRPRDYGEARTIGERFRDGTPVIMDLVEMSNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADIDVSAEERRRIAETGFYSQK

sepF

Cell division protein SepF

225 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.213 kDa

MSSLHKFKAYFGMVPLDDYEDEYLDEPEPTRRPARPARDSGRDPYHDRDDRDFAEPAFSKAAYAPGRRDDLDDDFDRYESPRHSSRVEPVAVRSARPSASGAVRGSTRGALAVDTRSDRVESRRGPLFDEGGPLSKITTLRPRDYGEARTIGERFRDGTPVIMDLVEMSNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADIDVSAEERRRIAETGFYSQK

sepF

Cell division protein SepF

224 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.265 kDa

MSTLHKVKAYFGMAPMDEYEDDYYEDDDRGPAPRGYRRPREDRFEDEGYAPRGYDGHPEDRRRDYDEPPAYRAGLAGGMPGGFDDARFEARMRAPREFDRTPPRFGAMRGSTRGALAMDPRGMAELFEAGSPLAKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTAEQRRRIAEAGFYSYQ

sepF

Cell division protein SepF

223 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.702 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRGPSRGYSRPRFEDDYGRYEGRDFEDPRRDPRADMRADLRGEPADYPPPGGYRGGYPDEARFQPREFDRADMARPRFGSWLRNPTRGSLAMDPRRMAMMFEEGHPLSKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

223 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.644 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRGPSRGYSRPRFEDDYGRYEGRDFEDPRRDPRAGMRADLRGEPADYPPPGGYRGGYPDEARFQPREFDRADMARPRFGSWLRNPTRGSLAMDPRRMAMMFEEGHPLSKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

220 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.145 kDa

MAIKDAFNKMISYFDTDGVSEVEEELSSKKQEEPVTKSQQTSRPNQQQQAARASQPQQPKQARPQMQAQQRPQSQSRAAYAERPYQGQSQARVSHDYNDRRATSAPSASSRREQYQHAAHQEQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQYMLDAQARRCLDFIDGASKVLYGTLQRVGSSMYLLTPSNVSVNIEEMNIPNNGQDIGFDFDMKRR

sepF

Cell division protein SepF

220 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.145 kDa

MAIKDAFNKMISYFDTDGVSEVEEELSSKKQEEPVTKSQQTSRPNQQQQAARASQPQQPKQARPQMQAQQRPQSQSRAAYAERPYQGQSQARVSHDYNDRRATSAPSASSRREQYQHAAHQEQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQYMLDAQARRCLDFIDGASKVLYGTLQRVGSSMYLLTPSNVSVNIEEMNIPNNGQDIGFDFDMKRR

sepF

Cell division protein SepF

220 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.146 kDa

MSTLHKVKAYFGMAPMDDYDDEYYEDDDRAERGAARGYARRPREDRFEEEGYIDRAGREYDDRPAPREYDEPPIYRGGYDEPRFDPRLRGPREFERPAPRLGALRGSTRGALAMDPRRMAMLFEEGSPLAKITTLRPKDYSEARTIGEKFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTADERRRIAEAGFYAYQ

sepF

Cell division protein SepF

220 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.146 kDa

MSTLHKVKAYFGMAPMDDYDDEYYEDDDRAERGAARGYARRPREDRFEEEGYIDRAGREYDDRPAPREYDEPPIYRGGYDEPRFDPRLRGPREFERPAPRLGALRGSTRGALAMDPRRMAMLFEEGSPLAKITTLRPKDYSEARTIGEKFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTADERRRIAEAGFYAYQ

sepF

Cell division protein SepF

220 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.146 kDa

MSTLHKVKAYFGMAPMDDYDDEYYEDDDRAERGAARGYARRPREDRFEEEGYIDRAGREYDDRPAPREYDEPPIYRGGYDEPRFDPRLRGPREFERPAPRLGALRGSTRGALAMDPRRMAMLFEEGSPLAKITTLRPKDYSEARTIGEKFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTADERRRIAEAGFYAYQ

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.249 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSSIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.219 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.249 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSSIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.219 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.219 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.219 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.258 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSSIANRRERYQQSTCSDQTTIALKYPHKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.249 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVTASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.249 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSSIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.219 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.219 kDa

MAFKDTFNKMISYFDTDEVNEVEEDVAASTDNVIPRSQQSVRASSHPKQEPRNNHVQQDHQARSQEQTRSQMHPKHGTSERYYQQSQPKEGHEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPRKYEDAQEIVDLLIVNECVLIDFQFMLDAQARRCLDFIDGASKVLYGSLQKVGSSMYLLAPSNVSVNIEEMTIPHTTQDIGFDFDMKRR

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.028 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRAPSRGYARPRFDDDYGRYDGRDYDDARSDSRGDLRGEPADYPPPGYRGGYADEPRFRPREFDRAEMTRPRFGSWLRNSTRGALAMDPRRMAMMFEDGHPLSKITTLRPKDYSEARTIGERFRDGSPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.028 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRAPSRGYARPRFDDDYGRYDGRDYDDARSDSRGDLRGEPADYPPPGYRGGYADEPRFRPREFDRAEMTRPRFGSWLRNSTRGALAMDPRRMAMMFEDGHPLSKITTLRPKDYSEARTIGERFRDGSPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.028 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRAPSRGYARPRFDDDYGRYDGRDYDDARSDSRGDLRGEPADYPPPGYRGGYADEPRFRPREFDRAEMTRPRFGSWLRNSTRGALAMDPRRMAMMFEDGHPLSKITTLRPKDYSEARTIGERFRDGSPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.028 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRAPSRGYARPRFDDDYGRYDGRDYDDARSDSRGDLRGEPADYPPPGYRGGYADEPRFRPREFDRAEMTRPRFGSWLRNSTRGALAMDPRRMAMMFEDGHPLSKITTLRPKDYSEARTIGERFRDGSPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

218 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

25.028 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRAPSRGYARPRFDDDYGRYDGRDYDDARSDSRGDLRGEPADYPPPGYRGGYADEPRFRPREFDRAEMTRPRFGSWLRNSTRGALAMDPRRMAMMFEDGHPLSKITTLRPKDYSEARTIGERFRDGSPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

216 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.325 kDa

MSNLHKFKAYFGMVPLDDYEDEYVEEPDQARRAPRRSHDGYAERDDREFVEPAFSKASYAPSRRDEEDAEFDRYDSRPRVDTVPSRSSRPAMAPRPASRGNLAVDARAERPEARRAPVVDDGGPLAKITTLRPQSYAEARTIGERFRDGTPVIMDLVDMSNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADIDVSAEERRRIAETGFYSQK

sepF

Cell division protein SepF

214 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.354 kDa

MSIFNKDALSSFFGLSGEEDDYYDNYEEYEERKAVNEPPRRAARPKPQRPVQQQESYSQPAYTQQSEPVVEKPSARYRSAEAHQERDTQQAAYTEKKVVSMRSSNQSATTNTRRAQESTANAKTHKITIIEPRVYSEAMSIAKHLFAEEAVLVNFTLVEEDQARRIVDFLTGTVYALDGDIQRVGNEIFLCTPANMEIDSATAQSLANKQFFDF

sepF

Cell division protein SepF

214 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.5 kDa

MSTLHKVKAYFGMAPMDDYEDEYYDDRAPSRGFPRPRFDDGYGRYDGDDYDDPRREPADYPPPAGYRGGYAEESRYGAVHPREFERPEMGRPRFGSWLRNSTRGALAMDPRRMAMMFEEGHPLSKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

214 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.44 kDa

MSTLHKVKAYFGMAPMDDYEDEYYDDRAPSRGFPRPRFDDGYGRYDGDDYDDPRREPADCPPPAGYRGGYAEESRYGAVHPREFERPEMGRPRFGSWLRNSTRGALAMDPRRMAMMFEEGHPLSKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

214 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.166 kDa

MSTLHKVKAYFGMAPMDDYEDEYYEDDDRGARAGGYSRRPREDRFEEEAYGYEGHEYDEGPAYRGGYAERFADEPRFEGRMRAPREFDRPAPARLGAMRGSTRGALAMDPRGMAELFEAGSPLAKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTAEERRRIAEAGFYSYR

sepF

Cell division protein SepF

213 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.81 kDa

MSTLHKVKAYFGMAPMDDYDDEYYDDVDAPAPRRAPVEDRRYPRRGERFADDAEYGYDEPGYRAGGPAGYADEDRFVSRHAPSREFDRPAPRLGSLRGSAPTRGALAMDPRRAAIFDEGSPLSKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRVVDFAAGLAFALRGSFDKVATKVFLLSPADIDVSAEERRRIAESGFYSYQ

sepF

Cell division protein SepF

212 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.601 kDa

MSALHKLKAYFGMVPADEIDEVYDDEVAYRDRYADPDTSYDAPSDRVGGRRRVAGGVRGGFQPEAEEDGGDYGEEFREPARSRRQWAPPETPVRAPLGSDAHREQVSRLRAVTDTGSHFNLSKITTLHPRSYSEARTIGEQYRDGTPVIMNLTEMDEADAKRLVDFAAGLAFALRGSIEKVTNRVFLLSPPNVDVAAEDKRRLAEGAFFNYG

sepF

Cell division protein SepF

211 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.021 kDa

MAFKDAINKMVSYFDTDEVNEVEEEVTAAKMEEPVVQEPKQRPIPSQQTSRQSQNPAMNRPTVARSQQTESDSLPTYPNRQESIDRRSSGRESVTASTARRETYQAQTTVQEGKTTIALKYPKKYEDAQEIVDLLIGNECVLIDFQFMLDAQARRCLDFIDGASKVLYGTLQKVGSSMYLLTPSNVSVNIEDMNIPNHNQDFGYDFDMKRR

sepF

Cell division protein SepF

210 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.2 kDa

MSSIFGKLREFVGFGEPTGYDYDYDEMEGDDYQGLYPAEPAQSLPTRSEEPHPRPSEPEMRSPVNTSAVTSTAMNPPMNQSMNNVVGMPGSGKWWGAVAEVIVMEPRSFEEMPQVIQALRERKSVVLNLTMMEPDQAQRAVDFVAGATYTIDGHQERIGESIFLFTPSCVQVSTQAGGQSHTLRDIPQAQIHTRPPAPAWTAEPLSRIAQ

sepF

Cell division protein SepF

210 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.417 kDa

MNNLLSKFKDFVGLNEPVEYEYDYDEMEGEQYVYPQQQQTPAAVPTQEESRSNRRLRNRASATTATTASTTGINGVVQQESGMGSVMNNVIGMPGALNGMSEVVVLEPRTFEEMPQAIRALRERKSVVLNLTIMDPEQAQRAVDFVAGGTYALDGHQERIGESIFLFTPSCVQVRTQTGLVNEMSQTQPRPRVPNSGSQVWQPEQIQMIQ

sepF

Cell division protein SepF

210 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

22.267 kDa

MAGALKKTMIYLGLADGDEYDEQPRAAEREAAPRHEVVEARRPAEPDTDPHMEAVRPAAVRDPEPAERPEPVTPSGSTAAEPVEPRRPARPEPVDPGYRAPVTPIKRAAASSAEGASVHTLSTVHPRSYNDAKAIGESFRSGVPVIMNVTDLGENEAKRLVDFAAGLVFGLHGSISRITSKVFLLTPATVDVVGAEQGESSVADSPFDGD

sepF

Cell division protein SepF

210 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.016 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRSPTHGYGRSRFEEGYGRYEGRDYSDLRGDPTGYLPLGYRGGYGDEHRFRPREFDRPDLSRPRLGSWLRNSTRGALAMDPRRMAMLFDEGSPLSKITTLRPKDYSEARTIGERFRDGTPVIIDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

210 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

24.016 kDa

MSTLHKVKAYFGMAPMEDYDDEYYDDRSPTHGYGRSRFEEGYGRYEGRDYSDLRGDPTGYLPLGYRGGYGDEHRFRPREFDRPDLSRPRLGSWLRNSTRGALAMDPRRMAMLFDEGSPLSKITTLRPKDYSEARTIGERFRDGTPVIIDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSPEERRRIAETGFYAYQ

sepF

Cell division protein SepF

210 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.915 kDa

MSTLHKVKAYFGMAPMDDYEDDYYEDDDRVPARGYRRPREDRFEDEAYPRGYDDRAREYDEPAGYRGGFDDARFEPRLRGPREFDRTPPRFGGLRGSTRGALAMDPRGMAELFEAGSPLAKITTLRPKDYSEARTIGERFRDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTAEQRRRIAEAGFYSYQ

sepF

Cell division protein SepF

206 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.332 kDa

MANLFKNILDSLKLTDDEDLDDYDDYVSELEEKERRKTERQEQRQAVKQEKRTFPSQRPAFSEEAPTSSSSKLSAASGSSDFADLRKERSQRMEKTNVSKVVPIRNPQKGLEVCIMKPTSFEDSQDICDMLLSGRAAVINLEGFDVDLAQRVMDFISGAVYSLNGKLHQISSYIFIISPDSVDISGDYLDLIRQNGFEVPTLNKDF

sepF

Cell division protein SepF

203 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

22.169 kDa

MPNKPGLWSRLVDYLGFGPEEDEFEDGELEQVQPAYQEEPPRRSAPERRGQVVPISAVPSKQGTVKVVVVEPRSFEEVQTIVDQMKARRPVILNLESLDKDLAQKILNFLNGAIYALNGETQRVSAGIFFYAPPGIDVSTMGRGLTGTAIGGGAVDLPPGVLEKLMGTASGSQEGDLLARTARRSEEGDRTGADRSKFDWRNQ

sepF

Cell division protein SepF

201 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.416 kDa

MALKDRFDKIISYFDTDDVSENEVHEVQERTSVQRDSRAATAQEASQRSHMTNSAEEEMIGSRPRTSTYNPNRQERQRVQRDNSYQQATPRIQNKDSVRQQREQVTIALKYPRKYEDAQEIVDLLIVNECVLIDFQYMLDAQARRCLDYIDGASRVLYGSLQKVGSSMFLLTPANVMVDIEEMNIPKTGQETSFDFDMKRR

sepF

Cell division protein SepF

201 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.463 kDa

MALKDRFDKIISYFDTDDVSENEVHEVQERTSVQRDSRAATAQEASQRSHMTNSAEEEMIGSRPRTYTYDPNRQERQRVQRDNAYQQATPRVQNKDSVRQQREQVTIALKYPRKYEDAQEIVDLLIVNECVLIDFQYMLDAQARRCLDYIDGASRVLYGSLQKVGSSMFLLTPANVMVDIEEMNIPKTGQETSFDFDMKRR

sepF

Cell division protein SepF

201 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.093 kDa

MALKDLFSGFFVVEEEDDELEAPPEENEQQERQQPKQQAQSQNQFTEQPRNVNSERPRSIQSVPKKQSTRLQQSSGERKYQMNNTTSKNNARNVVNMNNQEQENYDFTQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGSDIFLCTPDNVEVAGSITDQIENMEYQGE

sepF

Cell division protein SepF

201 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

23.387 kDa

MALKDRFDKIISYFDTDDVSENEVHEVQERTSVQRDSRAATAQEASQRSHMTNSAEEEMIGSRPRTSTYDPNRQERQRVQRDNAYQQATPRVQNKDSVRQQREQVTIALKYPRKYEDAQEIVDLLIVNECVLIDFQYMLDAQARRCLDYIDGASRVLYGSLQKVGSSMFLLTPANVMVDIEEMNIPKTGQETSFDFDMKRR

sepF

Cell division protein SepF

200 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

22.287 kDa

MNNIFSKLRDFVGLNEQVEYEYYEEEPETDNNYQNLYQQENPQPPAPQESATAQNRRWREPVPTMGDDIAAGSKPMGNVIGMPGAINGISEVLVLEPRTFEEMPQAIQALRERKSVVLNLTIMDPDQAQRAVDFVAGGTYALDGHQERIGESIFLFTPSCVQVSTQGGVLHEVPQPPARPSRPTGSPNQTWGNETNRMAQ

sepF

Cell division protein SepF

199 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

22.894 kDa

MSLKDRFDKFIDYFTEDGDETEVQEQTVSRPAAPVKQKPELVQPKPVRESKPAPRPAAAAKPQPKPQPKPQPQQKSSTENITRLHARQQELAQHRANADEKITIDVRYPRRYEEATEIVDLLLANESILIDFQYMTEVQARRCLDYLDGARYVLAGNLKKVASTMYLLTPINVVVNVEDIRLPNDVEISEFDFDMKRSR

sepF

Cell division protein SepF

198 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.937 kDa

MNNIFSKLRDFVGLNEQVEYEYYEEEADTDNYQNLYQQENPQPAPAEAAPNNRRWREPMTTMGDDVATGTKSAMGNVIGMPGAINGISEVLVLEPRTFEEMPQAIQALRERKSVVLNLTIMDPDQAQRAVDFVAGGTYALDGHQERIGESIFLFTPSCVQVSTQGGVIHEVPQPPARPARPASTNPPAWGNETNRMAQ

sepF

Cell division protein SepF

198 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.907 kDa

MNNIFSKLRDFVGLNEQVEYEYYEEEADTDNYQNLYQQENPQPAPAEAAPNNRRWREPMTTMGDDVAAGTKSAMGNVIGMPGAINGISEVLVLEPRTFEEMPQAIQALRERKSVVLNLTIMDPDQAQRAVDFVAGGTYALDGHQERIGESIFLFTPSCVQVSTQGGVIHEVPQPPARPARPASTNPPAWGNETNRMAQ

sepF

Cell division protein SepF

197 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

22.753 kDa

MALKDLFNNFFVVEEEEEVEGPEERESSRSRERVQEREDYNRNENQATPQTFNNKQQAIKSVPQKNTLRSNTTSEERNYRMNNNSKNNSRNVVTMNQASQSYTAQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDQVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEQHYE

sepF

Cell division protein SepF

197 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

22.739 kDa

MAIKDLFNNFFLMDDEEEVESPEERQRRVVQNEENETNNVQQNQPQQSERSYSNQSKLKTVPQKKTTRNYNSEERNVRMNQPPSKSNGKNVVTMNQTSQSYSGYESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKISAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIEQMESQHYE

sepF

Cell division protein SepF

197 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.722 kDa

MFNSIRNFLGFNEPEEYEEYYEGEIDNNDYHALYPAEMPTPLPEESAPAPRRLPENPTVASNFAMNSNTTPTRNNVIGLPGVSNSPAEVVVCEPHSFEEMPQIIQALRDRRSIVLNLNMMDPDEAQRAVDFVAGGTFAIDGHQERIGDSIFLFTPNCVQVTNSLSREETPATPAAPARPAAPAPAWSDEMTPMAQAQ

sepF

Cell division protein SepF

196 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.87 kDa

MAFKDWMNNLRDYFVEDDEEFNEPARPVQESRPTVASTPKPKVEERKAQPEYQTRRPAQSTSKAQTQTAAPKRAGSTFTKPMPEKIVQQQTVSQSQSVAATVSTIAIKEPRAYADIMESARIVKNGECVLVNFKFMGDAQARRSIDFMTGVVFTLDGDIQNVGGQIFLMTPANITVDAAKEMSILAGQNFESYDIY

sepF

Cell division protein SepF

196 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.938 kDa

MAFKDWMNNLRDYFVEDDEEFNEPTRPVQESRPTVASTPKPKVEERKVQADYQSRRPAQTTPKPQTQTAAPKRSASTFSKPMPEKIVQQQTVSQAQSLAATVSTIAIKEPRAYADIMESARIVKNGECVLVNFKFMGDAQARRSIDFMTGVVFTLDGDIQNVGGQIFLMTPANITVDAAKEMSILAGQNFESYDIY

sepF

Cell division protein SepF

196 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.894 kDa

MAFKDWMNNLRDYFVEDDEEFNEPTRPVQESRPTVASTPKPKVEERKVQADYQSRRPAQSTPKPQAQTAAPKRSASTFSKPMPEKIVQQQTVSQAQSLAATVSTIAIKEPRAYADIMESARIVKNGECVLVNFKFMGDAQARRSIDFMTGVVFTLDGDIQNVGGQIFLMTPANITVDAAKEMSILAGKNFESYDIY

sepF

Cell division protein SepF

195 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.792 kDa

MNTILTKLKDFVGISEHDDEYETDYEEMEYDRYSKTNSSETLAPEEEEPIRNRRTRESLNLTSDVPMGTTTRNNVIGMPGITNGIAEVVVIEPHSFEEMPQVIQTLRERKSVVLNLNVMDPEEAQRAVDFVAGGTYAIDGHQERIGESIFLFTPSCVKVSTLTGTVHDVPETPKATTRPTMSTPVWGAEASRIAQ

sepF

Cell division protein SepF

194 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.547 kDa

MSLISRLRAVVAGDDYLDSDYDDLDYDTDDHMDADHRSDHASGGALATPSDSSPFDLGGGFSGSNVIGMPGVGSTSAEVNLMEPRSFDEMPRAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVSNTSYDEASAPSMVSQDHDSVPSSSQQTGAAPVPAWEVTRAGGL

sepF

Cell division protein SepF

194 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.45 kDa

MSLISRLRAVVAGDDYLDSDYDDLDYDTDDHMDADHRSDHASGGALATPSDSSPFDLGGGFSGSNVIGMPGVGSTSAEVNLMEPRSFDEMPRAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVSNTSYDEASAPSMVSQDHDSVPSSSQQTGAAPVPAWEATSAGGL

sepF

Cell division protein SepF

192 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.682 kDa

MSLIQRLRAVVAGDDYLDSDFDELDDYSRDEFDAGNRNPREYTSGLASFSGSNPFDVSGGSSSNVIGMPGISTATAEVNLMEPRSFDEMPKAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVSVTNSFQEEPAPSNVTTTTQQSEETISESVTAPEPAWGTPVASAI

sepF

Cell division protein SepF

192 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.948 kDa

MSSFWSKVKDFVGFGDPLEYEEDGEEYEQVYREENKREEARRATAGTAAAATPTAAAQASDAAPMGSGPARKRVRAGNVIGMPNSGVNEVLVIEPRSFEEAPQIVQHLRDRKSVILNLTLMDSDQAQRSVDFVAGATFAIDGHQERVGDGIFLFTPSSVMISTEMPSQLRQANQAFGGNFRLNPEAPRRAQG

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.899 kDa

MSLISRLKAVVAGDEYLEDDFDELDYASEDELNDINNFKQNPKNANALANSNPFDFMNNNRSSKVVGMPGISNSSSEVSLMEPRSFDEMPQAIQALRERKTVILNLTMMDPDQAQRAVDFIAGGTYAIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVSTEKTPQYSLGKNTTPEPAWGNSKLSAYS

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.81 kDa

MSLISRLRAVVAGDDFLDSDFDELEYDSSDDFENFNRGNKEGSTEMATISQANPFDGRSGFPPSNVIGMPGISTNDSEVSLMEPRSFDEMPRVIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNSFQEEASPSNMSNKGNDLISKETSPAPEPAWGETVATAL

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.91 kDa

MSLISRLKAVVAGDEYLDDDFDELDYASEDELNDIDNFKNSPRNKNALANANPFDFMNNNRSSKVVGMPGISNSSSEVSLMEPRSFDEMPQAIQALRERKTVILNLTMMDPDQAQRAVDFIAGGTYAIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVPTENTPQYSLGKNTTPEPAWGNSKLSAYS

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.997 kDa

MSLISRLKAVVAGDDYLDDDFDELDYASEDELNGVNDYKENRKNSNALSNSNPFDFMNNNRSSNVVGMPGISNSSSEVSLMEPRSFDEMPQAIQALRERKTVILNLTMMDPDQAQRAVDFVAGGTYAIDGHQERVGESIFLFAPSCVNVTSSFPEEVSPSNISSKKTSPYSLETNTTPEPAWGESKLSAFS

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.941 kDa

MSLISRLKAVVAGDEYLDDDFDELDYATEDELNDINDFKQTQRNSNALANSNPFDFMNNNRSSKVVGMPGISNSSSEVSLMEPRSFDEMPQAIQALRERKTVILNLTMMDPDQAQRAVDFIAGGTYAIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVSPKNTPQYSVENNTAPEPAWGNSKLSAFS

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.147 kDa

MSLISRLKAVVAGDDFLDDDFDELDYASEDEFNGNDDLKQNYKKSNALSNSNPFEFMNNNRTSNVVGMPGIANSSSEVNLMEPRSFDEMPQAIQALRERKTVILNLTMMDPDQAQRAVDFVAGGTYAIDGHQERVGESIFLFAPSCVNVTSSFPEEASPSNVSSKKTSQYKFETNTTPEPAWGESKLSAYN

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.913 kDa

MSLISRLKAVVAGDEYLDDDFDELDYPSEDELNDINNFKQNPKNSNALANSNPFDFMNNNRSSKVVGMPGISNSSSEVSLMEPRSFDEMPQAIQALRERKTVILNLTMMDPDQAQRAVDFIAGGTYAIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVSTENTPQYSLGKNTTPEPAWGNSKLSAYS

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.838 kDa

MSLISRLRAVVAGDDFLDSDFDELDYETSDDFENFNRGKKEGSTEMATISQANPFDGRSGFPPSNVIGMPGISTNDSEVSLMEPRSFDEMPRVIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNSFQEEASPSNMSNKGNDLISKETSPAPEPAWGETVATAL

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.64 kDa

MALRDSFNKIISYFDTDEVSEVEEPAVASVKRQQDAAQPASQQQKAQSHQYHQSASRPSQQQVQSGQNRRSGEENIHSLPTRRQSHNQQPAQEKTTIALKLPRKYEDAEEIVDLLIRNECVLIDFQYMLEAQARRCLDFIDGASKVLAGNLQKVGASMYLLTPINVIVDAEEMTLAANGQDVSFNYDMKRR

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.004 kDa

MSFVNRIRDIVGLNESLDYDEEYETYDVAADSYNGYNDAAETSSRRRQRNHTPTASIEPVSTASNVIGLPGLSSSSEVVVMEPRSFEEMPQAIQALRERKTIVLNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFTPSCVHVTTQGGEQYLNESPAQPVQTTTSFGRTATPTPAWGTDSRYAAQ

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.138 kDa

MEGQDDYQLLYEGRRSQPAAPPEEEEVSTLPRGRRQRGVEAGEGSAGREESRGHRRSQHRDRSAGGSMGSNVIGLPGVNPPTSEVVVMEPRSFDEMAQVIQYLRERKTVIMNLTLMDPAEAQRSVDFVAGGTYAIDGHQERIGENIFLFTPSTVMVSTPSSQVVQPLQRPLQSPTPLWPSTYEHLQAVGQH

sepF

Cell division protein SepF

191 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.004 kDa

MSFVNRIRDIVGLNESLDYDEEYETYDVAADSYNGYNDAAETSSRRRQRNHTPTASIEPVSTASNVIGLPGLSSSSEVVVMEPRSFEEMPQAIQALRERKTIVLNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFTPSCVHVTTQGGEQYLNESPAQPVQTTTSFGRTATPTPAWGTDSRYAAQ

sepF

Cell division protein SepF

190 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.894 kDa

MSLISRLRAVVAGDDYLDGDYDDLDYDAGEHDDSPQAMASASSALAPLDAANPFDMDQGFSGSNVIGMPGISSSAAEVSLMEPRSFDEMPRAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNSAHEEASTPTVVTKDVEQASAEASVAPAPAWAAPGAAAL

sepF

Cell division protein SepF

190 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA (By similarity).

Belongs to the SepF family.

20.369 kDa

MLGKLRDLMGLTPETDIYDEEYPQGTARTLTTEPGVEPLPASPPTPTHDFDTRPSPSVATGSVPTGSTASNVIGMPNAGRWWGAVAEVLVMQPRSFSEMPEVIKALKERKSVVLNLTLMEPEQAQRSVDFVAGATFTIDGHQERIGESIFLFTPSCVQVSTQVGGVRPSATPTPTPPSAWGMDAQQHHSA

sepF

Cell division protein SepF

189 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.017 kDa

MSLISRLRAVVAGDDYLDGDFDELDYETGDDFDTGNDGGGNYSSGLAALSNANPFNNRGGSSKVIGMPGISTAAAEVSLMEPRSFDEMPKAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNSFQEEPSPSSVMNKDNEGPVSESVMAPEPAWGASVPSAI

sepF

Cell division protein SepF

189 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.61 kDa

MSLKDRFDKFIEYFTEDGDDVQVAESRVQQQAVKPSNSRPAQQEPVRDIKQPRLVSSSSQHVTNTPSSNENITRLHARQQELAQNHSVATSEKVTIDVRYPKKYEDAPAIVDLLLANESVLIDFQYMTEVQARRCIDYLDGAKQVLMGNLRRVSGTMYLLTPVNVVVNIEDIKLPDGVHSEFDFDMKRR

sepF

Cell division protein SepF

189 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.671 kDa

MAIKDAIEKIVSYFDADEVTDHEDVAKERPVKVQKTEQTPSQQQRKPERPQETVPPRRQHIKSDVQETQVLRSLSLSRSQVNQGSQQMNTTKTTIAIKYPKKYEDAQEIVELLIENECVLIDFQYMLEAQARRCLDFIDGASKVLTGNLQKVGSSMYLLTPINVVVDIEEIGLSHGNQESTFDFDMKRR

sepF

Cell division protein SepF

189 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.671 kDa

MAIKDAIEKIVSYFDADEVTDHEDVAKERPVKVQKTEQTPSQQQRKPERPQETVPPRRQHIKSDVQETQVLRSLSLSRSQVNQGSQQMNTTKTTIAIKYPKKYEDAQEIVELLIENECVLIDFQYMLEAQARRCLDFIDGASKVLTGNLQKVGSSMYLLTPINVVVDIEEIGLSHGNQESTFDFDMKRR

sepF

Cell division protein SepF

189 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.72 kDa

MAIKDAIEKIVSYFDADEVTDHEDVAKERPVKVQKTEQTPPQQQRKPERPQETVPPRRQHIKSDVQKTQVLRSLPLSRSQVNQGSQQMNTTKTTIAIKYPKKYEDAQEIVELLIENECVLIDFQYMLEAQARRCLDFIDGASKVLTGNLQKVGSSMYLLTPINVVVDIEEISLSHGNQESTFDFDMKRR

sepF

Cell division protein SepF

189 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.815 kDa

MEGQEDYQLLYEGRRSQPAPEEQEASALPRGRRQRGVEAGEGSVGREEARGHRRSQHRDRLGGGSMGSNVIGLPGVNPPTSEVVVLEPRSFDEMAQVIQYLRERKTVIMNLTLMDPAEAQRSVDFVAGGTYAIDGHQERIGENIFLFTPSTVTVSTPSSQGMPPLQRPLQSPTPLWPSGYEHLQAVGQH

sepF

Cell division protein SepF

188 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.945 kDa

MSLISRLRAVVAGDDYLDGDLDDLVYDDDQPEQDQRASQADGGALATIGDGNPFDLGDNFSGSNVIGMPGISTAAAEVNLMEPRSFDEMPRAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNTSHDEASTPTVVSRDAEAEQQQEAAAAPSPAWGATAL

sepF

Cell division protein SepF

188 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.877 kDa

MSLISRLRAVVAGDDYLDGELDDFAYEDEQQDQDQRATQADGGALATLGDSNPFDLGGDLPGSNVIGMPGISTAAAEVNLMEPRSFDEMPRAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNASQDETSAPTVVSREIDVAEPSESASAPSPAWGAAAL

sepF

Cell division protein SepF

188 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.862 kDa

MSLISRLRAVVAGDDYLDGELDDFAYDDEQDDQDQRALQADGGALATIGDSNPFDLGGDLPGSNVIGMPGISNAAAEVNVMEPRSFDEMPRAIQALRERKTVILNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNTGHDEASAPTVVSREADAADVDEYASAPSPAWGAAAL

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.991 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENVEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.023 kDa

MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRYTTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.695 kDa

MALKDTFKNLFNYFEVDEVNEVEEQADAYSMPNDRPKMRVANTTVAPVREQQPKVETRREARSESQLQRLHERQQELMTNNNEKEIVKTTIDIKFPKRYEDAPEMVNLLLDNASILIDFQYMSEQQARRCLDYLDGARSVLSGNLKKVSNTMWLLTPVNVTVNIEELRNAGTTTGVADSNFEFDIKR

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

21.695 kDa

MALKDTFKNLFNYFEVDEVNEVEEQADAYSMPNDRPKMRVANTTVAPVREQQPKVETRREARSESQLQRLHERQQELMTNNNEKEIVKTTIDIKFPKRYEDAPEMVNLLLDNASILIDFQYMSEQQARRCLDYLDGARSVLSGNLKKVSNTMWLLTPVNVTVNIEELRNAGTTTGVADSNFEFDIKR

sepF

Cell division protein SepF

187 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.957 kDa

MAGALRNAMVYLGLAEDDRYAEDTEPETTRPRVEAAREVRVESRHEARPEVRHEPRPEVSVERRPAPATTAQVTPIRKQVAHVVPQTSTTSSSPELHRITTIHPRTYNEAKTIGESFREGVPVIMNLTDMDDSDAKRLVDFSAGLVFGLHGAIERVTNKVFLLSPANVEVASQEEERPTERTFFNQS

sepF

Cell division protein SepF

186 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.889 kDa

MGVREQLERVAAYFGFGVDDDYYEDEEEEERYAKGSYGNGGRTGEPSPAVRRLGRSERSSAFGTSLGDLFGSEGPERGRYAHNPPHLRAVPDQRPTRVSVVEPSSFNDAQALADRFKRQQPVILNLQNVNSDLSRRMVDFCAGLTYALDGHIQTVANRVFLLTPRDVEVSAEERKMLAERAFFNQL

sepF

Cell division protein SepF

186 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.534 kDa

MILTKLKDFVGISEHDEYEEDYDEEMEFPQSVASQPPAEEVAPPPRISREPLSLNNETSIGTGVRNNVIGMPGINNSVAEVVVVEPHSFDEMPQVIQTLRERKSVVLNLNVMDPEEAQRAVDFVAGGTFAMDGHQERIGESIFLFTPNCVKVSSLAGRSQESNETSSSVSSDNFPTWGYETSRLAQ

sepF

Cell division protein SepF

183 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.536 kDa

MGMLDGLTNMFKMHDDDDFDDDYEDYDDDFDEDYEDDKPSARKRLFTGSSKKDSVADEEVSYTAEKPRFASKSKVVPMKTQSARGLEVVVIRPESMEDAKEITDTLLTGKAVVLNLEGIHVEIAQRIIDYSAGSTYAIRGNLQKITNYIFLVTPPNVDISGDIPEIVTGGIDLSSFNKNENRF

sepF

Cell division protein SepF

183 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.428 kDa

MSIFSRLKKVVAGDDYLDDDYGTELEYEDGLEPSDSTLDRGGAIAPIGSFDDGDPFASSNVIGMPGITSAAAEVLVMEPRSFDEMPKTIQALRERKTIILNLTMMEPDQAQRAVDFVAGGTYAIDGHQERVGESIFLFAPSCVTVTTASSEESAAPSVMAREEEATAPAAPSPAWGTQDAING

sepF

Cell division protein SepF

181 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.777 kDa

MGLGRRAMVYLGLAEEDEDYLDDDDYDDGRAVGHDDRRAMHEPVPMDRTVRRIDAREEPVAMPRRPPVEPLRPAGPVPMRRVMPVEETHPYRITTLQPRSYNEARQIGEEFRDGTPVIMNLTDMDDVDAKRLVDFAAGLIFGLRGDIEKVTNKVFLLSPHNVEVTETDKRRIREGGFYNQS

sepF

Cell division protein SepF

180 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.302 kDa

MSFIDKILDKMSLNSEDDEEFDNEDYYLDDEEEEELPRNPFRRKKEAVEEETAIKSTRRDTTPKEKPVKTTSKITPISKSSRKQVASDMEVCVIKPSSIEDEIEITDTLLNGRTVVINMEGLNVDVAQRIIDFTSGSAYALHGNLQKISNFIFIATPHGVDISGDIQSLMDSFDLPGSSY

sepF

Cell division protein SepF

180 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.553 kDa

MGLGRRAMVYLGLAEEDEDYLDDDYDDGRAVGRDDRRAMHEPVPMDRTVRRIDAREEPVAMPRRPPVEPLRPAGPVPMRRVAAVEESHPYRITTLQPRSYNEARQIGEEFRDGTPVIMNLTDMDDADAKRLVDFAAGLIFGLRGDLEKVTNKVFLLSPHNVEVTETDKRRIREGGFYNQS

sepF

Cell division protein SepF

180 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.715 kDa

MAFSFKSFFGGADDEEEEYEDSGYEQQPNQGQQQPVNSQQQNTSNQSYSGYNNQNQNRNGFAYDNGYRQQPKMSAVNSSTQSANNSAKIDSHIALFVPKVFSDAKTIVNQLLLHEAVIVNFSAIDETQSAKIVDFVAGAIYAVEGSIEKISDEIWLIAPNNYAVSGSGSAANSMGRNARF

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.637 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTPVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.627 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTSVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.637 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTPVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.526 kDa

MSLKDRFDRFIDYFTEDEDSTVPYEKGNEPVFTPVNSSQEPDLPMNQPSQSAGAKDSNITRLHARQQELANQSQRSTDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEEQNGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.637 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTPVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA (By similarity).

Belongs to the SepF family.

20.627 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTSVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.637 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTPVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.637 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTPVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.597 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTSVNSSQEPALPMNQPSQSAGAKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.665 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTPVNSSQEPALPMNQPSQSVGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

179 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

20.627 kDa

MSLKDRFDRFIDYFTEDEDSSLPYEKRDEPVFTSVNSSQEPALPMNQPSQSAGTKENNITRLHARQQELANQSQRATDKVIIDVRYPRKYEDATEIVDLLAGNESILIDFQYMTEVQARRCLDYLDGACHVLAGNLKKVASTMYLLTPVNVIVNVEDIRLPDEDQQGEFGFDMKRNRVR

sepF

Cell division protein SepF

178 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.926 kDa

MAGALRKTMIYLGLADGDEHYESEHHTPHKDEDDSMEHDREERRAPAPVREIARETPTPHAAEEEYRAPVTPIKRAASSREETTGLRQITTIHPRSYNDAKLIGESFRDGIPVIMNVTDMGEADAKRLVDFSAGLVFGLRGSIERVTNKVFLLSPSYVEVIGDDKKVSETQASFFNQS

sepF

Cell division protein SepF

178 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.778 kDa

MAGALRKTMIYLGLADGDEHYESEQSVATHHDEERPQAQEREERRAPAPVREVVREMPTVDAEEEYRAPVTPIKRAASSREDASGLRQITTVHPRSYNDAKVIGESFRDGIPVIMNVTDMGEADAKRLVDFSAGLVFGLHGSIERVTNKVFLLSPSYVEVIGDDKKASETQASFFNQS

sepF

Cell division protein SepF

176 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.727 kDa

MAGALRKTMIYLGLADGDEHYESEQLNTRKDEDETMEADREERRAPAPVREVSRETSYTPEEEYRAPVTPIKRAASSREETSGLRQITTIHPRSYNDAKLIGESFRDGIPVIMNVTDMGESDAKRLVDFSAGLVFGLRGSIERVTNKVFLLSPSYVEVIGDDKKASDTQASFFNQS

sepF

Cell division protein SepF

175 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.996 kDa

MAFMRKAAVYLGLVEDDEERYEDYDDYDDAEPHRREPREAVERDLGSRRTAVVRRMDARESSPADPAELRRVSEPAPTERPTPPLRVTTLHPRTYNEARAIGEHFREGIPVIMNLTEMDDADAKRLVDFAAGLTFGLRGSIERITSKVFLLSPRNVEVTAEDKRRMAEGGFFNQS

sepF

Cell division protein SepF

173 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.54 kDa

MAGALRKMAVYLGLVEDDRYDHRYADEYDDFEDFDEPLDERPSRNRSPRDDSRNNAVTDSSDHSPSRNERRSPAPAPATADLARITTLHPRTYNEARTIGEHFREGIPVIMNLTEMVDSDAKRLVDFAAGLIFGLHGSIERVTNKVFLLSPANVEVTAEDKARIAERGFFNQS

sepF

Cell division protein SepF

173 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.797 kDa

MAFKDVFKGFFAYEDEEVYVEEQSDKVREPAQKKVVKETYVPEKKVVRTESFQKQSKPKMKVNEEKVTKANVVNMHDDIVNVSSKVCLFEPRVFSDTQDIADELKNRRATLVNLQRIDKISAKRIIDFLSGTVYAIGGDIQRIGQDIFLCTPDNVEVAGTITEMLEAPEEENE

sepF

Cell division protein SepF

173 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.727 kDa

MAGALRRTMVYLGLAESDDEYISDETPRPRDTPQSAGGSSAAVSESGSTSVARRSPEYRAPVTPIKRAPSSREDENELRTITTVHPRSYNDAKSIGEAFRDGTPVIMNVSDMGEAEAKRLVDFAAGLVFALHGSIERVTAKVFLLTPSFVEVRDQGHSDDIDEEPASLEQVEG

sepF

Cell division protein SepF

172 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.022 kDa

MAGALRKTMIYLGLADGDEHYEPQPEGKQTRPAQKNEEYVDQEIRHTEPASAHQASEDEYRAPVTPIKRAASNRDDSSGLRQITTVHPRSYNDAKVIGESFRDGIPVIMNVTDMGEGDAKRLVDFSAGLVFGLHGSIERVTNKVFLLSPVFVEVIGDDKKASENQASFFNQS

sepF

Cell division protein SepF

172 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

19.464 kDa

MAGIGRKIASYVGIVDDRRYDEEDLPDEELTTEVYSDDGYEPSSEVTQLHHHDSNEQHARGHKAVQHRRRSELEEPSIADINRILTVHPRNYNEARTIGEQFREGIPVIMNLTEMDDADAKRLVDFAAGLIFGLRGTIERVTSKVFLLCPRNVNVTPEDKARIASGGFFNQS

sepF

Cell division protein SepF

168 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.378 kDa

MANPLKKTMVYLGLADEELEFEEEQTQHQPRREAAAPASVQPVPHPAAVAPVQNRAPVTPLRKSSTARNAPVQEMNEILTVHPRQYRDAQAIAESFREGIPVIINLSQMSEGDARRLIDFASGLSQGLYGKIERVTPKVFLLSPSHIVVSGEHGGQEAEVDASFFAQA

sepF

Cell division protein SepF

167 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.886 kDa

MNFFEKILVFLGLAEEAEEEIIEDEEDVAPVNNSTFQEKKHKKRSAVQRKQKNSDQEGDSVVPLHSTKNTQGIKIHLIAPSKYEEAQEIGKYLKSGFPVVVNLEQLEMETAKQMIDFVSGTVFALDGNLHKIGQQIFLFSPPNVGIDGAIDTTGDEFFDQKTYEEYE

sepF

Cell division protein SepF

165 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.082 kDa

MSGAMRRIGEYLGLLEDTGRYDDEYGDYAGDYETQETAPVATRSSKRESRPAPVSDLSERRRPASGPTGVVAELSRITTLHPSTYNEARTVGENFRDGTPVIMNLSEMDDADAKRLVDFAAGLVFATRGTIERITNKVFLLSPPNVSVAAEDKQRIAEGGFFNQS

sepF

Cell division protein SepF

164 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.837 kDa

MANPLRKTMVYLGLADEELDYQQGQQPAQQQQSPVQAVPTPAPAPQQQAKRAPVTPLHKPSTTTRNAAPAEMNEILTVHPKAYKDAQVIAENFREGVPVIINLSQMTDDDARRLIDFASGLSIGLYGKIERVTAKVFLLSPSHVAVSGEQSATEAEVEASFFGR

sepF

Cell division protein SepF

164 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.865 kDa

MANPLRKTMVYLGLADEELDYQQGQQPAQQQQSPVQAVPTPVPAPQQQAKRAPVTPLHKPSTTTRNAAPAEMNEILTVHPKAYKDAQVIAENFREGVPVIINLSQMTDDDARRLIDFASGLSIGLYGKIERVTAKVFLLSPSHVAVSGEQSATEAEVEASFFGR

sepF

Cell division protein SepF

164 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.52 kDa

MGFKTKMQNLFLGNTDDLDELEYENDATINKGRGASQQEYDEYYEDSTPTVTQKEDPVRQSNIVPIHTKKAKSQVILSEPRVFNEAQEIGEHLRQNRAVIVNMQRMSKDQSRQMINFLSGVVFALDGTITTISQNTLLCVPNNVELAGSISNLLGEDDINHKGW

sepF

Cell division protein SepF

163 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.056 kDa

MAKLVEKFYSIMGLGDEIEEMNDASVAPHSGEERESAFSRRSAERAERTERPTAPVVSLVTERQKKELKVVVCEPKTFDEARAIADHLKNRRQVILNLEKADREMAQRVIDFISGTTYALNGSMQKVGANIFVFAPSNVDISGEVTGDDLSSVRSPLAWANKG

sepF

Cell division protein SepF

161 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

18.653 kDa

MSFMNSFKKLVGVEDDYDEYYDDQYYYDESDHVESESKDYEQKQNYETKSNIVSMNNSATKPVESKPLNRVKINIHEPISFDDAPKVIDVILKNEVAVLNIEMLEKDVKQRIFDFVSGAIYSLDGKMQKVTKDIFVLVPKGVEIDGKIKDQITKNNGFFQL

sepF

Cell division protein SepF

160 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.124 kDa

MAGFMKNAMSYLGMSDVAEGEDDFEDDVDTGETSFDSDHSVTPMPSSSASASTPSAPREQSNPFQGGRVSRITTIHPKTYDDAQMVGRAIRDGIPVVLNLTGVAEAVAYRIVDFSAGVVFGVRGSIERVTPRVFLLSPAQVNIKVEEPEDKGPAHDLFAD

sepF

Cell division protein SepF

159 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.056 kDa

MAGFMKNAMSYLGMSDVVDDEDDYIEEDEEQKPASKSAFDSDHTVTPLASTTAPAASSTTKPFPGGRVNRITTIHPKSYEDAQLVGRALRDGVPVVLNLTGVAEAVAYRIVDFSAGVVFGVRGSLERVTPRVFLLSPAQVNIKVEEPTKPASAHDLFAD

sepF

Cell division protein SepF

159 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.056 kDa

MAGFMKNAMSYLGMSDVVDDEDDYIEEDEEQKPASKSAFDSDHTVTPLASTTAPAASSTTKPFPGGRVNRITTIHPKSYEDAQLVGRALRDGVPVVLNLTGVAEAVAYRIVDFSAGVVFGVRGSLERVTPRVFLLSPAQVNIKVEEPTKPASAHDLFAD

sepF

Cell division protein SepF

159 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.056 kDa

MAGFMKNAMSYLGMSDVVDDEDDYIEEDEEQKPASKSAFDSDHTVTPLASTTAPAASSTTKPFPGGRVNRITTIHPKSYEDAQLVGRALRDGVPVVLNLTGVAEAVAYRIVDFSAGVVFGVRGSLERVTPRVFLLSPAQVNIKVEEPTKPASAHDLFAD

sepF

Cell division protein SepF

157 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.667 kDa

MASKVLNKVMGIIGLNDEDFDEYEDEVMEEKAIARENSYDYDEKLNDKNSSNSNNKVVNIHTASSVKVVIVKPKDYDEATQICDDLKNRKIVVVNVTDLEPKTAQRLLDFMGGASYVLNGELLEIDKGVYLLSPSNVDISRDLKNDLASKSIFNWSK

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.782 kDa

MSKLLNKVFNFVGWEAVDEDEYEYDEQELNTKEEVKDEPIQTHFFNGSKKQQSGKVVNIHTGNQFKMIVSQPNTFDDAQDICDHLKNKKPVVINLEGIEKQDAQRIIDFLSGSVYALDGSIQKVSCDIFVIAPNNVDVSGDLKDELRNKTVFPWAK

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.725 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEDDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.725 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEDDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.739 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.725 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEDDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.739 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.743 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQTKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.328 kDa

MSIKNKMKDFFGLEEDPNSTYEEEEYAVANAAAPSTTETSVVRQDDRPKSANNLVALNTKKKDRSKVVLAEPRVFAEAQDISDHLKENRAVIVNLQRMSKEQSRQVVNFLSGVVYALEGSMTSIGHNTILCTPNNVELTGSISNLISEDELHSKGW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.125 kDa

MASKFFSNLFGVVDDEPETADYYEDQQPAQQAPAPVPTPAPTRSNKVVSINNARVAPQPNSSSKIELVEPRVYGDGKEIVNHLLNGNAVIVNFDQMDAKVAFRIVEYMKGATYAISGKIERIDAEIFLCTPQNFEISGKLAPTLSSDGLDDRGDRY

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.723 kDa

MSWSKVKYFFFDTPEEKEAAQYGYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEETNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.739 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.723 kDa

MSWSKVKYFFFDTPEEKEAAQYGYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEETNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.743 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQTKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.777 kDa

MSWSKVKYFFFDTPEEKEAAQYAYEKEQIEMKKQQEPPEQQDVPFTKVQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGKRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKLGPKTFMCTPENVDIVGAISELFGEEEETNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.743 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQTKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.723 kDa

MSWSKVKYFFFDTPEEKEAAQYGYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEETNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.739 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.739 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVTFPKAQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGIADHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.767 kDa

MSWSKVKYFFFDTPEEKEAAQYSYEKEQTDMKKQQDPPEQQDVPFAKVQPKQNVVSIETAKQSSKVVLLEPRTYSEAQGISDHLKGRRAVVINLQRMSTDQAVRIVDFLSGTVYAIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEETNIKRW

sepF

Cell division protein SepF

156 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.13 kDa

MAGFMKRTMSYLGMSDVVPEDEDDEVIDEEPESSFDTDRSVTPIPAASTQPSTSQRKSVAPFHANINRITTIHPQSYEDAQLVGRALRDGIPVVLNLTDVSQSQAYRIIDFSSGVVFGISGSIERVTERVFLLSPARVDIVAEDTESGMSDNLFEN

sepF

Cell division protein SepF

155 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.41 kDa

MSTILNKVLNFVGWETEDEEEDVETVEESEDVEEEESKKPQFIQPLSSRRTQNKVVNIHSASQFKVIVMQPESFNDAKDVCDHLKSKKPVVVNLGSVQKEVAQRIVDFLSGSVYALDGSIQKVSNDIFIVAPHNVDIMGDFKGDITGKAVFPWLK

sepF

Cell division protein SepF

155 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.708 kDa

MGFKTKFKRYFNLDDHVEEVERYVEEPEQRDERPALEKGRAPKEKQTAGMEQNQNIVSLQSVQKSAKMILLEPRSYDEAQDIADHLKRRKAVVINLLRIEQEQALRIVDFLSGTVYAIGGDIQKIGPGIFLCTPDNVEITGSISDWVTRQTDSTV

sepF

Cell division protein SepF

153 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.055 kDa

MAKKMLNKVMDFLGLEEEIDEIEEMDNEAIVEGNEEIDNIFDSSNVRNQKGKVVSIHTTTSTKVLILKPMDYDAAIEICDNLKSRKIIVVNMTSLESKIAQRLLDFIAGASYALGGSLDEIDKGVYIVSPSNVEITNELKNELSTKGILNWTK

sepF

Cell division protein SepF

153 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.173 kDa

MAGKVLNKVMGFLGLEDEYEYEEYYEDTDELENSNESAEFEPIIHSNKKQGKVVSIHSTSTPKVSIVKPKTYDEVVDICDDLKDGKIVIVNSIELDPKVGQRLVDFVSGATYSLNGTLEEIEKGIYILSPSNVEVDSELKNQLSSKGMFSWNR

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.269 kDa

MSNGIISKFKNWIVDEEEDYIEDEYESGMDDIVQEEEMNSGFSTAKANKIVNLHTTSQMKVVIVEPKVYDEAATIADHLKQRRAVIVNLEGLTNSEVRKSIFNFMNGAVYVLDGSIQKVSKSIFILAPNNVDIDANMKKELESKAFFPWQNK

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.5 kDa

MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPSKNRFYAVEEEDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKDYKTVVVNLQRISHDQATRIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVNGSISEMLDEQNFM

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.514 kDa

MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPNKNRFYAVEEDDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKEYKSVVVNLQRISHDQATRIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.514 kDa

MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPNKNRFYAVEEDDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKEYKSVVVNLQRISHDQATRIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.514 kDa

MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPNKNRFYAVEEDDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKEYKSVVVNLQRISHDQATRIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.514 kDa

MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPNKNRFYAVEEDDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKEYKSVVVNLQRISHDQATRIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.516 kDa

MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPSKNRFYAVEEEDAKVVSMQGAQYSSRMVLAEPRVYAEAQELADYLKDYKTVVVNLQRISHDQATRIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVNGSISEMLDEQNFM

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.467 kDa

MSIKNKFKSFFTLDDEEYEYEYIDEEREPVQEEKGTKDKAAFQERPQTGKQNVVSLQSVQKSSKVVLSEPRVYAEAQEIADHIKNRRAVVVNLQRIQHDQAKRIIDFLSGTVYAIGGDIQRIGSNIFLCTPDNVDVSGTISELLTEEEPQRW

sepF

Cell division protein SepF

152 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.595 kDa

MSMKNKLKNFFSMDEEEYEYEYIETEQDHPEEHEQQKDKQPAYAQKPQGKQNVVSLQSVQKSSKVVLSEPRVYAEAQEIADHLKNRRAVVVNLQRIQHDQAKRIVDFLSGTVYAIGGDIQRIGSDIFLCTPDNVDVSGTISELINEDEHQRW

sepF

Cell division protein SepF

151 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.191 kDa

MTMAKLFDKVIGIMGFADDDYEDDYFEEEEEKEEVREETRGTGNRKGAQVVSIHTQKQIKVVVMEPQAFEDSQSIADQLRNRRPVIVNLENAERNLAKRIVDFVSGATYALGGNMQKVGNGIFLFVPNNVDISGEMKDDFKEKGFFWSLTK

sepF

Cell division protein SepF

151 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.703 kDa

MAFEKLGEKFSNFFAMDNEDDYQDQEDEQAQQPAPEQPVDNHYRSNKVVSMATPAGKTAKIVVYEPRVYSDAKEIGSHLLNNRAVVINFDRIGSDDATRIVDFLTGTVFAINGEIKRVGESIFLVTPANFEIDGSLASTIDSDGLNLSSQH

sepF

Cell division protein SepF

151 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.703 kDa

MAFEKLGEKFSNFFAMDNEDDYQDQEDEQAQQPAPEQPVDNHYRSNKVVSMATPAGKTAKIVVYEPRVYSDAKEIGSHLLNNRAVVINFDRIGSDDATRIVDFLTGTVFAINGEIKRVGESIFLVTPANFEIDGSLASTIDSDGLNLSSQH

sepF

Cell division protein SepF

151 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.223 kDa

MGMKSKFKRFFELDDDASMYEEDAVSRDFVEEVEEPRRRSRTGVKQERETGQNVVSLQSVQKTAKVVLLEPRTYDEAQEIADQLKNRKAVIINLQRISHEQAKRVVDFLSGTVYAIGGDIQKLGMNIFLCTPDNVDVTGTITDMIQDGYRS

sepF

Cell division protein SepF

151 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.386 kDa

MSMKNKLKNFFSMEDEEYEYEYIETERESHEEHEQKEKPAYNGNKPAGKQNVVSLQSVQKSSKVVLSEPRVYAEAQEIADHLKNRRAVVVNLQRIQHDQAKRIVDFLSGTVYAIGGDIQRIGSDIFLCTPDNVDVSGTISELISEDEHQRW

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.561 kDa

MSGKILDKMAGLLGLEDDLEEDLEEVEEETAEEEVTPLISSNTKRNNKVVSIHTAVSAKVKIIKPCSYEEAVDICDELKNRKIIIVNTTDLETKIAQRLLDFMGGASYALGGSLEEVEKSVYILAPSTVEVTNELKSQLISSKGIFNWNK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.561 kDa

MSGKILDKMAGLLGLEDDLEEDLEEVEEETAEEEVTPLISSNTKRNNKVVSIHTAVSAKVKIIKPCSYEEAVDICDELKNRKIIIVNTTDLETKIAQRLLDFMGGASYALGGSLEEVEKSVYILAPSTVEVTNELKSQLISSKGIFNWNK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.114 kDa

MGNVISKVKSLLGFEDYEEYDEYEEEQYEEQVKDEDEIEPVITNKKNSKVVNIHTSSTTKVTITKPIDYEEATEICEALKNRRIVLVNTTVLELKIAQRLLDFISGSCYALGGELQQIEKGVYILSPSNVEVTNELKNELSSKALFNWSK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.561 kDa

MSGKILDKMAGLLGLEDDLEEDLEEVEEETAEEEVTPLISSNTKRNNKVVSIHTAVSAKVKIIKPCSYEEAVDICDELKNRKIIIVNTTDLETKIAQRLLDFMGGASYALGGSLEEVEKSVYILAPSTVEVTNELKSQLISSKGIFNWNK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.589 kDa

MSGKILDKMAGLLGLEDDLEEDLEEVEEETVEEEVTPLISSNTKRNNKVVSIHTAVSAKVKIIKPCSYEEAVDICDELKNRKIIIVNTTDLETKIAQRLLDFMGGASYALGGSLEEVEKSVYILAPSTVEVTNELKSQLISSKGIFNWNK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.561 kDa

MSGKILDKMAGLLGLEDDLEEDLEEVEEETAEEEVTPLISSNTKRNNKVVSIHTAVSAKVKIIKPCSYEEAVDICDELKNRKIIIVNTTDLETKIAQRLLDFMGGASYALGGSLEEVEKSVYILAPSTVEVTNELKSQLISSKGIFNWNK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.72 kDa

MAGKMINKMMGFLGLEDDLEEDIEEVEEGKNTKNDFTDVESIMNSKRQNKVVSIHTTISAKVRIVKPTTYEEAADICDELKNRKIIVINTTGLETRIAQRLLDFMGGASYALGGDLEEIEKGVYILSPSSVEVSSDLKNELSAKKIFGWK

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.073 kDa

MSLSEKLSNWFNGVPEEEYYEEVTDSKQAVSTNTDVTRASEPEKDNNRQVMSLMSSKNNSTTVQREQKIMVFDPSVFSDVKNIGKMILNGRAVIVNFRKMDENQIHRVIDFLSGLIFAVNGDMQRIGEKIFLCTPKNFKIEGDLSNLTGR

sepF

Cell division protein SepF

150 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.277 kDa

MSLKNKFKNFFSLDDEEYEYEYIETDREEIPEEHESKDRTAYQSKAAGKQNVVSLQSVQKSSKVVLSEPRVYAEAQEIADHIKNRRAVVVNLQRIQHDQAKRIVDFLSGTVYALGGDIQRIGADIFLCTPENVDVSGTISELIEEEHQRW

sepF

Cell division protein SepF

149 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.621 kDa

MSKVVSKMKSFLGFDEFEDEDEVMEEEEVMEEEESFAPVLSSKKNGKVVNIHTANTAKLMITKPLVYDDATEICTALKNRKIVVINTTSLELRTAQRLIDFVGGACYALCGELQEVEKGVFIVSPSNVEVSNELKSELSNKGMFNWASK

sepF

Cell division protein SepF

149 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.621 kDa

MSKVVSKMKSFLGFDEFEDEDEVMEEEEVMEEEESFAPVLSSKKNGKVVNIHTANTAKLMITKPLVYDDATEICTALKNRKIVVINTTSLELRTAQRLIDFVGGACYALCGELQEVEKGVFIVSPSNVEVSNELKSELSNKGMFNWASK

sepF

Cell division protein SepF

149 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.621 kDa

MSKVVSKMKSFLGFDEFEDEDEVMEEEEVMEEEESFAPVLSSKKNGKVVNIHTANTAKLMITKPLVYDDATEICTALKNRKIVVINTTSLELRTAQRLIDFVGGACYALCGELQEVEKGVFIVSPSNVEVSNELKSELSNKGMFNWASK

sepF

Cell division protein SepF

149 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.612 kDa

MALGDTIKRLFSNEEDDYYEEDGYEQSQQQEQQTTQQTSSQPRFVRQTTQSQTPAGLNSANSKIALFEPKVYSDSRSIASQILGGEAAIVNFTQIDEAQAKRILDFLGGTIYAVNGEIERIGQSIFLVTPNTFEISGTLTDNLEPNSRY

sepF

Cell division protein SepF

149 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

17.044 kDa

MAFKLVDKVLSFMGFEEEVVEEEEKRARDEIVEEQPWQRKKEKDRGAVLSLHAQRQVRVVVVEPRAFDEVQGIADNLKNRRPVIVNLEQAEPDLAKRIVDFISGATYALNGSLQKVGSGIFLFVPNNMDIASDLKDPQKEKGIFTWMRS

sepF

Cell division protein SepF

148 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.641 kDa

MSAKFIDKVKYFIGLDAFEDDNEDMLEEADGMDDEMIPISSTSKKNKILNIHTTTQMKVVIFEPSSFEEAPGIVDNLKNRKPVIINLENIEPDLAKKFFDFLNGAIYALDGNIQKVASGIFILAPNNVDISGNIKEELKNKGVFPWQK

sepF

Cell division protein SepF

148 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.753 kDa

MNNKFKDFFGFGDNDSYEERDAYEEHYDEQEEMQNSNRPTNSRDSNVVSIKAGQAGSGPSKIVLYEPRVYSDAKEVAQNLLNQRAIIINFSRMDDASARRVVDFITGTVYALNGEIQRIGDKIFLATPPKFETDGKITELLDKKDTLG

sepF

Cell division protein SepF

146 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.643 kDa

MSGKIIDKVKVFMGFDVFEDEEVEEEETVEIEDELVPVMNSKRNKVVNIHTTTQMKVVLYEPTNFEEAPNIVDNLKNRKPVIINLENIEPDLAKKFFDFLNGAIYALDGNIQKVSSGIFILAPNNVDISGNIKEELKNKGVFPWQK

sepF

Cell division protein SepF

146 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.845 kDa

MAFWQGLINWLGYGHEGEEPVMEKPVLEAETTPVTPAKGKLVGLPTARNAMRLVIARPQSFEQAAGLAENLKNYRPLIVNVEGIPVEEARRIIDFLSGAAYALGGRVRKVTSGIFLFTTSNVDLSGDLEDQIPGGLNWLEAAGRGR

sepF

Cell division protein SepF

145 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.767 kDa

MFDNLQRKFLNLIGIEIEEEDKPQEVSKTKDENAKPKHETPKVVTIGKANQTEVTVYNLKLFDEVVKVCDALRENKIVVFNLEQVAEEHIQRIIDFVSGAVYVLDAKIHKVSKKIFVVVPRSIDLEVDEQLKEEFRSKGVFAWLK

sepF

Cell division protein SepF

145 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.781 kDa

MFDNLQRKFLNLIGIEIEEEDKPQESTKAKEENVKPKHETPKVVTIGKANQTEVTVYNLKLFDEVVKVCDALRENKIVVFNLEQVAEDHIQRIIDFVSGAVYVLDAKIHKVSKKIFVVVPRSIDLEVDEQLKEEFRTKGVFAWLK

sepF

Cell division protein SepF

145 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.269 kDa

MAFDKLGRFFGISNDDELANDEEYTTQNEENNEDLPLNSINRDNVVSIKSGLNSSKSKIVLYEPRVYSDAKDVAQNLLNNKAVVINFSRMEDSSARRIVDFITGTVYTLNGEIQRIGDKIFLATPPKFVTDGKISDLVDKKDNLS

sepF

Cell division protein SepF

145 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.226 kDa

MAFDKLGRFFGISNDDDELEKEEYTTSNKDENENLPLNSVSRDNIVSIKSGLNSAKSKIVLYEPRVYSDAKDVAQNLLNNKAVVINFSRMEDSSARRIVDFITGTVYALNGEIQRIGDKIFLATPPKFVTDGKISDLVDKKDNLS

sepF

Cell division protein SepF

144 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.604 kDa

MGLIKKFKDYFLEEDYEEYEEYEEEYEEEEEMRQATKANTKSNVVSLQSVQKSSKVVLIEPRAYAEAQEIADHLKNRRAVVVNLQRIQHEQAKRIVDFLSGTVYAIGGDIQQVGTKIFLCTPDNVDVTGSISIDSDDDTSMKRW

sepF

Cell division protein SepF

144 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.923 kDa

MAGKFSFSNFFGMTEDEDYSTDLQGTKTTDEVSPTSRPDNIISMTAAGNAKMNKIVLCEPRIYSDAKKVGKHLLENKAVIVNFTRIEGAQASRIIDFLTGTVFAINGEIQRVGEQIFLCTPPNYEIDGNLSDIIDQNDFDSEVN

sepF

Cell division protein SepF

144 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.217 kDa

MAFDKLGRFFGIAEDDEMNEAPYTEAEQQEEEVPQAQKNERRANVVSINSGVGATSKIVLYEPRVYSDAKEVAQNLLNNKAVIINFARMDDEQARRIVDFITGTVYALNGEIQRVGDKIFLATPPKFETDGKIAELVEKKDKMD

sepF

Cell division protein SepF

144 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.351 kDa

MAFDKLGRFFGISEDDEMNEVPYTESEEQQEEIPQTQKNERRANVVSINSGVSATSKIVLYEPRVYSDAKEVAQNLLNNKAVIINFARMDDEQARRIVDFITGTVYALNGEIQRVGDKIFLATPPKFETDGKIAELVEKKDKMD

sepF

Cell division protein SepF

144 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.647 kDa

MSFKNKLKDYFMGDEYEYEYVDEDNQSEEPTQKEAKVNPKNVVNLSSVQQSNSRVVLIEPRNYNEAQEIADNIVNRRAVIINLQRVDHQQAKRIVDFLSGTVYAVKGDIQKLGAETFLCTPDNVEVSGTITEMLYEQEEYDKGW

sepF

Cell division protein SepF

143 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.32 kDa

MGLMKKFRDYFLEEDYEDYEEEYEAPQQEEEALPLKTANKTNVVSLQSVQKSAKVVLAEPRVYAEAQEIADHLKSRRAVIVNLQRIQHEQAKRIVDFLSGTVYAIGGDIQQVGTKIFLCTPENVDVSGAISLDGEDDRPMKRW

sepF

Cell division protein SepF

143 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.64 kDa

MAEKFSLSKFFGMNDEYDDDYAEEPTPATKSTPTPPTRPNDSRKVVAMRTAKPNASHIAICEPRIYSDAKSIAKQLTNGDAVIVNFARVDEAQAQRIVDFLNGTAYAVGGEIKRIGEQIFLCTPHNFEVSGDVAANLGTQVTR

sepF

Cell division protein SepF

142 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.247 kDa

MGVMNKLMGFLGLENEEYIEETTTVEEEREEQESSHKRQPAISRTNNVVPFQAREKEGIRLILCEPRHYSDAQDIADNLRHRRPVVVNLHRVEKDQAKRIIDFLSGTVYALNGDIQKVGDTIFVCTPDHVDIQGTISSVLEE

sepF

Cell division protein SepF

142 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.105 kDa

MGLMKKFRDYFLEEDYEDYEEEYEAPQPEEEALPKTAGKANVVSLQSVQKSAKVVLAEPRVYAEAQEIADHLKSRRAVIVNLQRIQHEQAKRIVDFLSGTVYAIGGDIQQVGTKIFLCTPENVDVSGSISLDGEDDRPMKRW

sepF

Cell division protein SepF

142 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.212 kDa

MGVMDGLWRWLGVEREEVREEIIELPAYSEENQRGPTNVVSIHSNKTFKVVVCEPESFDEVQVLADHLKSRKQLILNFDNTPPEVSQRIIDFISGTTYSLEGHSQQLGKNIFIFTPSNVEIAKDHRSLMRKHGFANPFGGEK

sepF

Cell division protein SepF

141 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

16.2 kDa

MMGFVKKIRDFFDLDEEKWEEDEYEQEEVAQQPKVEQKQNVVSLQSVQKSSKLVLFEPRAYAEVQEIADHLKNRRAVVVNVHRVDRDQARRIVDFLSGTVYAIGGDIQQVGSTIFLCTPDNVDVSGSISIVSDDEPTIKRW

sepF

Cell division protein SepF

140 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.291 kDa

MAGFISNFFGVGDSDSQYEEPTEASQAAAPTESATNTRSTPKVVPMQGGKSVNSKIALFEPKIYSDVKEIATQLLKNQAVIINFDHVDDEMARRIVDFLTGTVFAINGEIERIGDEIFLCIPENYEVSGSTTSQFDTSKL

sepF

Cell division protein SepF

139 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.444 kDa

MAEGGFWKKLTNFFTASEEDEDIIEEDYMDEGYEAEEGTGFVPVQTRAVPVGSTIWVYQPSSFSFDVDSSFIGARIKDGYIIILNLQDLDDLSAQRLIDFVSGALYSVEGKLKAISSSVFLLVPKNVRVESFNEGFGTE

sepF

Cell division protein SepF

138 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.639 kDa

MNNKFKDFFGFGDNDSYEERDAYEEHYDEQEEMQNSNRPTNSRDSNVVSIKAGQAGSGPSKIVLYEPRVYSDAKEVAQNLLNQRAIIINFSRMDDASARRVVDFITGTVYALNGEIQRIGDKIFLATPPKFETDGKIT

sepF

Cell division protein SepF

138 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.245 kDa

MAANFLKSLFGEEDIDEQDGLYETSEQVSTPANTSNKVVSINSGRLNQMSQISLYEPRLYADVKQIASQLLEGHAVIVNFTQMDANVAARLVDFLNGTVFAIDGEMKRIGKEIFLCTPKNYEISGSLTSNLKNDGDKF

sepF

Cell division protein SepF

138 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.245 kDa

MAANFLKSLFGEEDIDEQDGLYETSEQVSTPANTSNKVVSINSGRLNQMSQISLYEPRLYADVKQIASQLLEGHAVIVNFTQMDANVAARLVDFLNGTVFAIDGEMKRIGKEIFLCTPKNYEISGSLTSNLKNDGDKF

sepF

Cell division protein SepF

137 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.537 kDa

MSGGFLDKVLNFMGFSEEEEEEYVEKEPAKKVRGKANLVALPGMSMLKMMVFEPRSFDEVQGIADSLKSGSPVVVNLERIDGELGRRIIDFLMGTTYALGGHLHKINPQIYLFAPQNVLIEGEMREFRDKTFFNPFK

sepF

Cell division protein SepF

137 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.687 kDa

MSSKMIDKLMSFFGIDEPEEEKEEVDSLQPVIPYDRKPKIVNIHTQPQVKVLILKPEKFEQVMNICNELKNKKPVIVDLQKMDKNEAQRVVDFLSGAAYALNGEIKKISGYIFLVAPENFDITGDIKDEVNSLYNLN

sepF

Cell division protein SepF

137 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.687 kDa

MSSKMIDKLMSFFGIDEPEEEKEEVDSLQPVIPYDRKPKIVNIHTQPQVKVLILKPEKFEQVMNICNELKNKKPVIVDLQKMDKNEAQRVVDFLSGAAYALNGEIKKISGYIFLVAPENFDITGDIKDEVNSLYNLN

sepF

Cell division protein SepF

134 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

15.155 kDa

MSSKVIDKIMSFLGIEEEEEEIQTPQPVVSYDRRPKVVNIHTNPQIKVLISKPEKFEQVLSICNELKSKKPVIVDLQKMDKSEAQRVVDFLSGAVYALNGEITKISGYIFLVAPENFDVTGDIKEEVNALYNLN

sepF

Cell division protein SepF

123 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

13.751 kDa

MAGGLKKAMVYLGLAEDNQELHSAPSGMSHLRRVPHPKQQMSEIFTFHPKKYSEVSGIVERFRQNIPVIIDMSQLSDTDARRMIDFASGLSQGLVGKIERVVGKVFLLSPEHISISTESKKEE

sepF

Cell division protein SepF

123 amino acids

Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

13.751 kDa

MAGGLKKAMVYLGLAEDNQELHSAPSGMSHLRRVPHPKQQMSEIFTFHPKKYSEVSGIVERFRQNIPVIIDMSQLSDTDARRMIDFASGLSQGLVGKIERVVGKVFLLSPEHISISTESKKEE

sepF

Cell division protein sepF homolog

108 amino acids

May act as a cell division protein.

Belongs to the SepF family.

12.699 kDa

MTFDYTNSFYNYDQYNNKKFDIVVLKPLKEEEIEYYLMQSLDALRINKAVVFNFEHIDYPLAQRILDSLAGATYALGGDKTCIREKLYFFVPKTVKLQAPNNETPSFF