Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of FtsZ protofilaments. Its function overlaps with FtsA.

Belongs to the SepF family.

155 amino acids

MSTILNKVLNFVGWETEDEEEDVETVEESEDVEEEESKKPQFIQPLSSRRTQNKVVNIHSASQFKVIVMQPESFNDAKDVCDHLKSKKPVVVNLGSVQKEVAQRIVDFLSGSVYALDGSIQKVSNDIFIVAPHNVDIMGDFKGDITGKAVFPWLK

17.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sepF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here