rsiW

Anti-sigma-W factor RsiW

221 amino acids

Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

24.429 kDa

MKTCHSHDELIHIYLDGDATKEQKEELYAHLQSCPSCREHLQELKKSIAFIQSSSHIEAPEGFTAGVMAKLPKTKKTAKWKLKAKRHPILVAAAIFLIMMSAAFFSAWSHTTDGIAVSGNGPFVIDKEAGVVVVPEGEVIDGDLVVRNGTLVLEGEVRGNVLLINSRFNKDTLYASPNQVTGEIEEVDKALSWAWYNMKEFFNEVVAVFDAGEDDPHSTDN

rsiW

Anti-sigma-W factor RsiW

213 amino acids

Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

23.947 kDa

MSCEQHYRTLIDKYIDGEATAEERQELNEHLETCDACFEYMLEVRKVVAFVQSASHVQAPEGFTENVMKNLPKRKQTNRFKVWMRRYPLAVAAAVFVLLMSTSLFSMWSSDGEHVTVTGTGNVSIDQESGRVIVPEGEVIQGDLVVRNGELIIEGEVQGNVLLVNSSQYLASPGSVSGEIDEVNQILDWIWYHTKKFLTKVIDISDEKNSPSS

rsiW

Anti-sigma-W factor RsiW

213 amino acids

Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

23.927 kDa

MSCSKDYLNLMHIYLDGDITREDESKLSRHLEDCESCQKHFHELNRTITLMRSAERVEAPDGFTENVMANLPSEKKTVKYRRWFKLHPMWTAAAIFLVLMAGGMISTWTHSSDQLVVSAQNELIVDGDTVIVPAGVTVPGDVLVKNGDLLLLGTVDGDVTIFNGKILDNDSEMNGEGLMASVGGVNGELETIDRMFEWIWYNIKNFFKGVFSF

rsiW

Anti-sigma-W factor RsiW

208 amino acids

The anti-sigma factor for extracytoplasmic function (ECF) sigma factor sigma-W (SigW). Holds SigW, its cognate ECF sigma factor, in an inactive form until released by regulated intramembrane proteolysis (RIP). SigW and RsiW mediate cell response to cell wall stress (PubMed:12207695). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut periplasmically (site-1 protease, S1P, PrsW) (PubMed:16816000, PubMed:17020587), then within the membrane itself (site-2 protease, S2P, RasP) (PubMed:15130127), while cytoplasmic proteases finish degrading the anti-sigma factor, liberating sigma-W (PubMed:16899079).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

23.341 kDa

MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEMEKSIALVRSTSHVEAPADFTANVMAKLPKEKKRASVKRWFRTHPVIAAAAVFIILMGGGFFNSWHNDHNFSVSKQPNLVVHNHTVTVPEGETVKGDVTVKNGKLIIKGKIDGDVTVVNGEKYMASAGQVTGQIEEINQLFDWTWYKMKSAGKSVLDAFNPNGEE

rsiW

Anti-sigma-W factor RsiW

206 amino acids

Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

22.828 kDa

MSCPEHIVQLMHKYLDGDILPEDETRLKEHLQSCEGCKKHLHEMEKSIALVQSTSHLTAPANFTANVLANLPKEKRTASINRWLKAHPFLVAAALFAILMGGSFFSSWKNDHDFSVSSQPNLVVKNNTVIVPEGEVVKGDVTVKNGKLIIEGKVDGDVTIVNGEKYTASAGQVTGQIHEINEVFDWIWYKIKSTGKSVFGVKESKE

rsiW

Anti-sigma-W factor RsiW

203 amino acids

Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

22.693 kDa

MECPKEIVLLMHSYFDGDLQPEGEQQLKEHLRSCAACAAHFHELKKTVAFLQYAAHVAAPPSFAAKVMEAMPKERKTARLRRFLHRHPLLTAASLFLALTLGSLASSWGERGAFSVSADEHVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGDVTVIHGKKYMASAGQVTGEVEEINQVFEWIWYNIKERFNRALQSIE