Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity).

Belongs to the zinc-associated anti-sigma factor (ZAS) superfamily. Anti-sigma-W factor family.

203 amino acids

MECPKEIVLLMHSYFDGDLQPEGEQQLKEHLRSCAACAAHFHELKKTVAFLQYAAHVAAPPSFAAKVMEAMPKERKTARLRRFLHRHPLLTAASLFLALTLGSLASSWGERGAFSVSADEHVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGDVTVIHGKKYMASAGQVTGEVEEINQVFEWIWYNIKERFNRALQSIE

22.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rsiW using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here