plyE

Probable pectate lyase E

257 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

27.32 kDa

MYQKLLLVPLLLTSALASPHDASSHQKFHQLNERAAFPIPASKGSQTFKEPYYVKGTYDGGMKTFGRGVKCTGQKEGGDKDAVFIVADGGILRNAIIGADQIEGVHCEGSCTIENVWWQEVCEDALTFKGTGTGVHKVIGGGAQGADDKVIQHNSGGSAIIQDFTVQNFGKLYRSCGNCKKQFKRTVQISGVKASNGKTLVGINPNLGDSATIDGCASSVKEICVEYEGTDNNGKEPKKAHSGPSNTCKFKEPLASC

plyE

Probable pectate lyase E

257 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

27.32 kDa

MYQKLLLVPLLLTSALASPHDASSHQKFHQLNERAAFPIPASKGSQTFKEPYYVKGTYDGGMKTFGRGVKCTGQKEGGDKDAVFIVADGGILRNAIIGADQIEGVHCEGSCTIENVWWQEVCEDALTFKGTGTGVHKVIGGGAQGADDKVIQHNSGGSAIIQDFTVQNFGKLYRSCGNCKKQFKRTVQISGVKASNGKTLVGINPNLGDSATIDGCASSVKEICVEYEGTDNNGKEPKKAHSGPSNTCKFKEPLASC

plyE

Probable pectate lyase E

254 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

27.065 kDa

MLQSLLLLPLFLTSAFATPHDPTAHQALEKRATFPIPSSKGSVTLRSTQYVKGTFDGGMKTYGRGVECTGQKEGGEKDAVFVVEEGGILKNVIIGADQIKGVYCKGSCTIQNVWWKDVCEDALSLKGSGSGTYKIIGGGAQNADDKVIQHNSGGTVMIQGFTVSNFGKLYRSCGNCSKQYKRSVQISGVKAYNGKTLVGINSNYGDTASIDACASSVKDICVEYEGTNNNGKEPKKKSSGPSKACEYNQPLKKC

plyE

Probable pectate lyase E

254 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

26.828 kDa

MYQPLLLLPLLLTSAFATPHDPTTHQALEKRASFPIPSSKGSVTYSSPKTISGTFDGGLKTYGRGVKCTGQKEGGEKDAVFVLEDGATLKNAIIGADQIEGVYCKGSCTIQNVWWTDVCEDALSLKGTGSGTHRIIGGGARNADDKVIQHNSGGKVIIQDFTVQNFGKLYRACGNCSKQFKRTVEISGVKASSGKALVGINSNYGDTATISGCASSVKEICVEYEGTDNNKKEPAKKSSGPSNACKYKEPLASC

plyE

Probable pectate lyase E

254 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

26.828 kDa

MYQPLLLLPLLLTSAFATPHDPTTHQALEKRASFPIPSSKGSVTYSSPKTISGTFDGGLKTYGRGVKCTGQKEGGEKDAVFVLEDGATLKNAIIGADQIEGVYCKGSCTIQNVWWTDVCEDALSLKGTGSGTHRIIGGGARNADDKVIQHNSGGKVIIQDFTVQNFGKLYRACGNCSKQFKRTVEISGVKASSGKALVGINSNYGDTATISGCASSVKEICVEYEGTDNNKKEPAKKSSGPSNACKYKEPLASC

plyE

Pectate lyase E

254 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester.

Belongs to the polysaccharide lyase 3 family.

27.015 kDa

MYQPLLLLPLLLTSAFANPHDPHIHHSLEKRASFPIPSSKGSVTFSSPKTISGTFDGGMKTYGRGVKCTGQDEGGDEDAVFILKDGATLKNAIIGADQIEGVHCEGSCTIENVWWTDVCEDALSLKGSGSGTHKIIGGGARNADDKVIQHNSGGKVIIQDFTVQNFGKLYRACGNCKKQFKRTVKISGVKASSGKALVGINSNYGDTASIKGCATSVKEICVEYEGTNNNSKEPKKKSSGPSSYCKYSEPLSKC

plyE

Probable pectate lyase E

254 amino acids

Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

26.807 kDa

MYQPLLLLPLLLTSAFATPHDPTTHQALDKRASFPIPSSKGSVTYSSPKSVSGTFDGGLKTYGRGVKCSGQKEGGDKDAVFILEDGATLKNAIIGADQIEGVHCKGSCTIQNVWWTDVCEDALSLKGSGSGTHRIIGGGARNADDKVIQHNSGGKVTIQDFTVQNFGKLYRACGNCSKQFKRTVEISGVKASSGKSLVGINSNYGDTATISGCASSVKEICVEYEGTDNNDKEPKKKGSGPSNACKYKEPLSKC