Pectinolytic enzyme consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins. Favors pectate, the anion, over pectin, the methyl ester (By similarity).

Belongs to the polysaccharide lyase 3 family.

254 amino acids

MYQPLLLLPLLLTSAFATPHDPTTHQALEKRASFPIPSSKGSVTYSSPKTISGTFDGGLKTYGRGVKCTGQKEGGEKDAVFVLEDGATLKNAIIGADQIEGVYCKGSCTIQNVWWTDVCEDALSLKGTGSGTHRIIGGGARNADDKVIQHNSGGKVIIQDFTVQNFGKLYRACGNCSKQFKRTVEISGVKASSGKALVGINSNYGDTATISGCASSVKEICVEYEGTDNNKKEPAKKSSGPSNACKYKEPLASC

26.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make plyE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here