pbsA

Heme oxygenase

238 amino acids

Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae.

Belongs to the heme oxygenase family.

27.058 kDa

MVNTLANELREGTTKSHSMAENVSFVKSFLGGVVDKKSYRKLVANLYFVYCAIEEELFSNKNHPAIKPIYFTELNRKASLSEDLNYYYGSDWLDFIEPSPATKIYVDRIHTIGHKQPELLVAHAYTRYLGDLSGGQILKKIARGAMNLSDSGGTKFYDFDQIKDDKLFKDQYRAALDMIPLSDVQIQNIVSEANISFTLNMKMFEELNSSSLKIITMLIANTIQKFKAKYKSTLAMVD

pbsA

Heme oxygenase

237 amino acids

Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae.

Belongs to the heme oxygenase family.

27.631 kDa

MSNNLAIQLREGTSKSHSMAENVSFVKSFLSGVIDTNSYKKMMSNLYFVYKAMEEEMEYHKENDLIKPIYFVELNRSESLALDLNFYYGDTWKDIIEPSEATRVYINRIKKISKEKPLLLIAHAYTRYLGDLSGGQILKKIAQRALNVPNSQGLAFYEFDKIDDEQAFKQKYKKALDTLPVTDKMISQIVAEANIAFNLNMRMFQELEMSYIRIFTKILMQFLINSKDKLRVMLNFS

pbsA

Heme oxygenase

236 amino acids

Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae.

Belongs to the heme oxygenase family.

26.752 kDa

MVSSLANELREGTTKSHSMAENVSFVKSFLGGVVDKKSYRKLIANLYFVYSAIEEEILLNKDHPAIKPIYFTELNRKTSLAKDLNYYYGPDWLNIIEPSSATQVYVNRIHNIGNKQPELLVAHAYTRYLGDLSGGQVLKKIARGAMNLSDERGTKFYDFDEIEDDKIFKNNYRSALDTIPLSDEQVQNVVAEANISFTLNMKMFEELNSSIVKIITMIIVSTVRKFTLKSILATAD

pbsA

Heme oxygenase

235 amino acids

Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae.

Belongs to the heme oxygenase family.

27.144 kDa

MIYDTNLALQLRQGTTKAHSMAENVSFVKSFLGGVVDKQAYRQLIANFYFVYSAIEDEMKRHQESQIIKPIYFEELNRKSSLEEDLQFYYGLEWQDKIFPSPATKVYINRIHEISNTSPELLIAHCYTRYLGDLSGGQILKKITQSAMNLSGGEGTAFYEFKDIKDEKNFKQNYRLALDSIHLSDSAIKSIVSEANIAFKLNMKIFQELNSNFIKIIAIFLFNFIKRIKLPGFKS