Catalyzes the opening of the heme ring with the release of iron. Key enzyme in the synthesis of the chromophoric part of the photosynthetic antennae.

Belongs to the heme oxygenase family.

235 amino acids

MIYDTNLALQLRQGTTKAHSMAENVSFVKSFLGGVVDKQAYRQLIANFYFVYSAIEDEMKRHQESQIIKPIYFEELNRKSSLEEDLQFYYGLEWQDKIFPSPATKVYINRIHEISNTSPELLIAHCYTRYLGDLSGGQILKKITQSAMNLSGGEGTAFYEFKDIKDEKNFKQNYRLALDSIHLSDSAIKSIVSEANIAFKLNMKIFQELNSNFIKIIAIFLFNFIKRIKLPGFKS

27.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pbsA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here