Function
In vitro, readily hydrolyzes p-nitrophenyl-alpha-D-glucopyranoside 6-phosphate (pNPalphaG6P), a chromogenic analog of the phosphorylated isomers of sucrose. In vivo, is probably involved in the degradation of the 6-phosphate derivatives of the sucrose isomers trehalulose, turanose, maltulose and palatinose, catalyzing their hydrolysis into glucose 6-phosphate (G6P) and fructose, which allows the bacterium to use these sugars as energy sources for growth. Is not able to hydrolyze the C2 or C4 chromogenic stereomers (i.e. pNPalpha-mannopyranoside-6P and pNPalpha-galactopyranoside-6P, respectively).
Sequence
MKKFSIVVAGGGSTFTPGIVLMLLENLDKFPIRQIKFYDNDAQRQEVIAKACDIIIKEKAPDINFVYTTDPETAFTDIDFVMAHIRVGKYAMREKDEKIPLRHGVLGQETCGPGGISYGMRSIGGVIELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNSKILNICDMPIGIEIRMAEMLGLKSRKDMVIRYFGLNHFGWWTDIRDKKGNDLMPALREKVAKIGYNVEIEGENTEASWNDTFTKARDVFAIDPTTMPNTYLKYYFFPDYVVEHSNPNHTRANEVMEGREKFVFGECRAIAEKGTAKDSKLHVDDHASYIVDLARAIAYDTKERMLLIVENDGAISNFDPTAMVEVPCIVGSNGPEKIVQGKIPQFQKGLMEQQVSVEKLTVEAWMEGSYQKLWQAITLSRTVPSASVAKAILDDLIEANKDFWPVLK