In vitro, readily hydrolyzes p-nitrophenyl-alpha-D-glucopyranoside 6-phosphate (pNPalphaG6P), a chromogenic analog of the phosphorylated isomers of sucrose. In vivo, is probably involved in the degradation of the 6-phosphate derivatives of the sucrose isomers trehalulose, turanose, maltulose and palatinose, catalyzing their hydrolysis into glucose 6-phosphate (G6P) and fructose, which allows the bacterium to use these sugars as energy sources for growth. Is not able to hydrolyze the C2 or C4 chromogenic stereomers (i.e. pNPalpha-mannopyranoside-6P and pNPalpha-galactopyranoside-6P, respectively).

Belongs to the glycosyl hydrolase 4 family.

440 amino acids

MKKFSIVVAGGGSTFTPGIVLMLLENLDKFPIRQIKFYDNDAQRQEVIAKACDIIIKEKAPDINFVYTTDPETAFTDIDFVMAHIRVGKYAMREKDEKIPLRHGVLGQETCGPGGISYGMRSIGGVIELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNSKILNICDMPIGIEIRMAEMLGLKSRKDMVIRYFGLNHFGWWTDIRDKKGNDLMPALREKVAKIGYNVEIEGENTEASWNDTFTKARDVFAIDPTTMPNTYLKYYFFPDYVVEHSNPNHTRANEVMEGREKFVFGECRAIAEKGTAKDSKLHVDDHASYIVDLARAIAYDTKERMLLIVENDGAISNFDPTAMVEVPCIVGSNGPEKIVQGKIPQFQKGLMEQQVSVEKLTVEAWMEGSYQKLWQAITLSRTVPSASVAKAILDDLIEANKDFWPVLK

49.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pagL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here