pafA

Alkaline phosphatase PafA

546 amino acids

Alkaline phosphatase with broad substrate specificity. Has phosphatase activity towards nucleotide phosphates with a preference for ATP. Active towards a great variety of phosphomonoesters with the exception of 2',3'-cyclic AMP and myo-inositol hexakisphosphate.

60.753 kDa

MLTPKKWLLGVLVVSGMLGAQKTNAVPRPKLVVGLVVDQMRWDYLYRYYSKYGEGGFKRMLNTGYSLNNVHIDYVPTVTAIGHTSIFTGSVPSIHGIAGNDWYDKELGKSVYCTSDETVQPVGTTSNSVGQHSPRNLWSTTVTDQLGLATNFTSKVVGVSLKDRASILPAGHNPTGAFWFDDTTGKFITSTYYTKELPKWVNDFNNKNVPAQLVANGWNTLLPINQYTESSEDNVEWEGLLGSKKTPTFPYTDLAKDYEAKKGLIRTTPFGNTLTLQMADAAIDGNQMGVDDITDFLTVNLASTDYVGHNFGPNSIEVEDTYLRLDRDLADFFNNLDKKVGKGNYLVFLSADHGAAHSVGFMQAHKMPTGFFVEDMKKEMNAKLKQKFGADNIIAAAMNYQVYFDRKVLADSKLELDDVRDYVMTELKKEPSVLYVLSTDEIWESSIPEPIKSRVINGYNWKRSGDIQIISKDGYLSAYSKKGTTHSVWNSYDSHIPLLFMGWGIKQGESNQPYHMTDIAPTVSSLLKIQFPSGAVGKPITEVIGR

pafA

Pup--protein ligase

504 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

55.735 kDa

MSPVTGEETPAEQQGTADNPVYVRRIMGLETEYGITNVLDGTRRLGPDEVSRLLFSPIVEKYRSSNIFTENASRLYLDVGAHPEIATAECDSLHQLLAYDRAGDELVQQLASRAEEELASNGIGGNVFLLKNNTDSMGNSYGCHENYLISRNVLLKHLSSQLLPFLVTRQLICGAGKLTIPSPGAPNENFEAGFMMSQRADYMWEGISSATTRSRPIINTRDEPHADSSKYRRLHVIVGDSNMSETTTALKIGSALLVLEMIEAGAELPNYELANEIRAIRDIARDFTGLTEVKLRSGETATPLEIQRTFHAAAVHWLEHRPEPECVDGRWLGTPREQLAPVVELWGRVLDCFETGDFSPVDTEIDWVIKKKLLHGMASRHGLEMTDPRLAQIDLRYHDIHPARGLFNVLKRRGQAASILGEEQIREAMDQAPATTRAALRGRFLTAAREHGCATTVDWMRLKINGEFGSEVALPNPFAATDPQVDEMIASMADLGDTDATARG

pafA

Pup--protein ligase

496 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

55.439 kDa

MPQLHDSGSRAIQPSDQTHQHDFARIFGIETEYGVSVTDIPEPMDASHVAMTMFQPVVRRARSTNTYVENGSRLYLDVGSHPEYATAEAICPSDALLSDLAGEQTMRSMGLDAQRRLRESDAQNRHATLHLYKNNADSAGHSFGCHENYLVRRFVNLDMIQHVLLPFLITRQIYTGAGRFDGERLLFTQRAAFVDETVSSATTRSRPMINTRDEPHANPDDYRRLHVIIGDSNRSQWATLMKCATTHLVLCMMEHAARSGCETELEAFALADPIAANHAINTDGAHARIALAAGRSTTALELQQMMLEQVESFAAHHGDALEASLRYDALCNVEWIVGQWRWVLDRLAANDIETLSHVVDWASKQVFFNRLQSRGTVTPARLRQLDLDYHDIANGRLYPSLCAHGLMRTLVDADQIHDAVSTPPPHTRAVLRGRFVAAASHTDAVYDCDWTTLKLVRPVHMEAVLLDPFHDEPTKQYDKLMGELGDARADGDEAPV

pafA

Pup--protein ligase

496 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

55.439 kDa

MPQLHDSGSRAIQPSDQTHQHDFARIFGIETEYGVSVTDIPEPMDASHVAMTMFQPVVRRARSTNTYVENGSRLYLDVGSHPEYATAEAICPSDALLSDLAGEQTMRSMGLDAQRRLRESDAQNRHATLHLYKNNADSAGHSFGCHENYLVRRFVNLDMIQHVLLPFLITRQIYTGAGRFDGERLLFTQRAAFVDETVSSATTRSRPMINTRDEPHANPDDYRRLHVIIGDSNRSQWATLMKCATTHLVLCMMEHAARSGCETELEAFALADPIAANHAINTDGAHARIALAAGRSTTALELQQMMLEQVESFAAHHGDALEASLRYDALCNVEWIVGQWRWVLDRLAANDIETLSHVVDWASKQVFFNRLQSRGTVTPARLRQLDLDYHDIANGRLYPSLCAHGLMRTLVDADQIHDAVSTPPPHTRAVLRGRFVAAASHTDAVYDCDWTTLKLVRPVHMEAVLLDPFHDEPTKQYDKLMGELGDARADGDEAPV

pafA

Pup--protein ligase

496 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

55.439 kDa

MPQLHDSGSRAIQPSDQTHQHDFARIFGIETEYGVSVTDIPEPMDASHVAMTMFQPVVRRARSTNTYVENGSRLYLDVGSHPEYATAEAICPSDALLSDLAGEQTMRSMGLDAQRRLRESDAQNRHATLHLYKNNADSAGHSFGCHENYLVRRFVNLDMIQHVLLPFLITRQIYTGAGRFDGERLLFTQRAAFVDETVSSATTRSRPMINTRDEPHANPDDYRRLHVIIGDSNRSQWATLMKCATTHLVLCMMEHAARSGCETELEAFALADPIAANHAINTDGAHARIALAAGRSTTALELQQMMLEQVESFAAHHGDALEASLRYDALCNVEWIVGQWRWVLDRLAANDIETLSHVVDWASKQVFFNRLQSRGTVTPARLRQLDLDYHDIANGRLYPSLCAHGLMRTLVDADQIHDAVSTPPPHTRAVLRGRFVAAASHTDAVYDCDWTTLKLVRPVHMEAVLLDPFHDEPTKQYDKLMGELGDARADGDEAPV

pafA

Pup--protein ligase

490 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

54.082 kDa

MEHRIFGIESEFGLSYVPHGLGRLSIEESAAALFKPVLDQWRSTNVFLPNGGRLYLDVGSHPEYASAECGSIDELLAQERAGELLFADLARTARKRLLAGSEGRPLDGELYLFKNNVDSAGNSYGSHENYLISRKLQFNDLIAQLVPFLVTRQILVGAGKTHPNGGPVPGSTDPASSTGVPSYSFSQRADHIWEAASTSTSRARPLINTRDEPHADASKFRRMHVINGDSNMAEPTTLLKIASTDLVLRMLEDRFPVTSLDIVSVPAALRAISHDLTGTATFETTDGKHYTALSVQRHYLDAARQYVQQYGAHHHHVEYALDLWQRTLDAIESGDYSSIDSEIDWAIKKKLLDAYIARARAAGQPADYASARIRQLDLAYHDIDPERSVFHALVRRGAVKRILPEGAAEAAKTQPPNTRALQRSRFINAAVAAGEQFTVDWVHLKLNAYPQHTLVCKDPFATDSEGLEEVLTLLEGKARQHQEAAFPPPC

pafA

Pup--protein ligase

489 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

55.039 kDa

MSAEVTHTGQHPETGALTRRIMGVETEYGITCMDGEVRRLRPDEIAKYLFRPVVDKYSSSNIFIPNASRLYLDVGSHPEYATAECDSLTQLINAEKAGDVIVNRMAVEAEAALAREGIGGQVYLFKNNVDSIGNSYGCHENYLVRREVSLKALGRRLMPFLITRQLISGAGMIQHPNPMSKGEGFPLGYCISQRADHVWEGVSSATTRSRPIINTRDEPHADSHRYRRLHVIVGDANMAEPTIALKVGSTLLVLEMIEADFGLPDMELSNDIESIREIARDQTGRIPLKLKDGTTRSALEIQQVVFDHARRWLDHRVESRGTSNEEMARVLDLWGRMLSAIETQDFSQVDQEIDWVIKKKLLDRYQTRGNLGLDDPRLAQIDLTYHDIRPGRGLFSVLQNRGMITRWTTDEAINHAVDHAPETTRAHLRGRILKAADKLGAPVTVDWMRHKVNRPDPQLVELSDPFSPVDAEVDALIAYMEAHAETYRT

pafA

Pup--protein ligase

488 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

54.408 kDa

MPQLRDSGNHSTAPLDAHTKDEIQSFARIFGIETEYGVSVTGSDRPCDAGQTAMMMFQPIVAEARSTNTYIENGSRLYLDVGSHPEYATAEARDPMDALALDAAGELVMRDLALDAQRRLRSIQGAGSTVHVFKNNVDSAGHSFGCHENYLVRRFVPLKTIEQELLPFLITRQLFTGAGRMGEQGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDAFRRLHVIIGDSNRSQWATMMKLATTHLVLCVIEQAGREGKDSGFARFSFADASAANHKVSRDLTGVEASFDMADGTVMEGGAVAIQERYLEIVERFVGQHPEVCSSLPRTDVHEVIRRWRRVIEAFRSGVSETFADKVDWLAKRRLFDMLRNRAGGRLSVSKLEQLDMDYHDVANGALYASLCRRGAMRTLVNESQAHEAIDVPPHDTRAALRGRFIQSARSHNAQYSCDWTRLSLTSPNRMDVTLLDPFDAQPSDRFLTILEALQ

pafA

Pup--protein ligase

488 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

54.068 kDa

MMPQLRDSGNHSTAPLDGRTRGEVDAFIRIFGIETEYGVSVTGADAPCDAGQTAMMMFQPIVAQARSTNTYIENGSRLYLDVGSHPEYATAEARDPMDALALDAAGELVMRDLAMDTQHRLREGHGRRAIVHVFKNNADSAGHSFGCHENYLVRRFVPLETIEHELLPFLITRQIFTGAGRVGGQGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDAFRRLHVIIGDSNRSQWATMMKLATTHLVLCVIEQAGREGRESGFARFAFADPGAANHAVSRDASGVGAVFDMADGDVIRGGAVAVQERYLAAVERFVEDHPEVGASLPRTDVHDVIAQWHEALEAFRSGDVDALADRVDWVCKKRLFDALQARTGHLPASRLEQLDMDYHDVANGTVYASLCRRGGMRTLLGRDAADRAVHMPPDDTRAALRGRFVREAKAKGARYSCDWTRLTLMSPHHSEMVLLDPFDFEESERFRQMMDMLA

pafA

Pup--protein ligase

486 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

54.154 kDa

MPQLRDSGTRSLHATEPVPSAEMDGFCRIFGVETEYGVAVTGAERPVDAGQVAMTMFQPIVSRSRSTNTYLTNGSRLYLDVGSHPEYATAEARDPREALAQDLAGEHVMRNLALKAQRKLRESYGAHATIHVFKNNVDSAGHAFGCHENYLVRRFVPLETIEHQLLPFLITRQLYTGAGRMTPDGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDSFRRLHVIIGDSNRSQWSTWMKLAVTHLVLCAIEDAFRHGTPSGFEHCAFADPAAANRTVSRFLDDPHAELTLESGESVSALGLQRRYYAAVKAFIETHVDALASSLPATTIDTIMGEWSRVLDALERGAYDALADRVDWAAKKRLFDALKRRRPDVTFAQMEQLELDYHDIANGRLYGSLVARNQMRELLTGDNVEYAVHNPPTDTRAALRGRFVDAALNVGAQFSADWTHLTLTAPERREAILLDPFEAEPTLGFEQLMEALN

pafA

Pup--protein ligase

486 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

54.066 kDa

MPQLRDSGTRSLHATEPVPSAEMDGFCRIFGVETEYGVAVTGAERPVDAGQVAMTMFQPIVSRSRSTNTYLANGSRLYLDVGSHPEYATAEARDPREALAQDLAGEHVMRNLALKAQRKLRESYGAHATIHVFKNNVDSAGHAFGCHENYLVRRFVPLETIEHQLLPFLITRQLYTGAGRMTPDGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDSFRRLHVIIGDSNRSQWSTWMKLAVTHLVLCAIEDAFRHGVPSGFEQYAFADPAAANRTVSRFLDNPRAELTLESGESVSALGLQRRYYAAVKAFIETHGDALAGSLPATTIDTIMGEWSRVLDALERGAYDALADRVDWAAKKCLFDALKRRRPDVTFAQMEQLELDYHDIANGRLYGSLVARNQMRELLTGDNVEYAVHNPPTDTRAALRGRFVDAALNVGAQFSADWTHLTLTAPERREAILLDPFEAEPTLGFEQLMEALN

pafA

Pup--protein ligase

485 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

54.077 kDa

MPQLRDSGTRSLHATEPVPSAEMDGFCRIFGVETEYGVAVTGAERPVDAGQVAMTMFQPIVSRSRSTNTYLANGSRLYLDVGSHPEYATAEARDPREALGQDLAGEHVMRNLALKAQRKLRESYSEHATIHVFKNNVDSAGHAFGCHENYLVRRFVPLETIEHQLLPFLITRQLYTGAGRMTPDGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDSFRRLHVIIGDSNRSQWSTWMKLAVTHLVLCAIEDAFRLGTPSGFEHCAFADPAAANRTVSRFLDDPHAELTLESGESVSALGLQRRYYAAVKAFIETHGDALASSLPATTIVTIMGEWSRVLDALERGAYDALADRVDWAAKKRLFDALKRRRPDVTFAQMEQLELDYHDIANGRLYGSLTSRNQMRELLTGDDVEYAVHNPPTDTRAALRGRFVDAALNVGAQFSADWTHLTLTAPERREAILLDPFEAEPTPEFEQLMEAL

pafA

Pup--protein ligase

482 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

53.801 kDa

MSTVESALTRRIMGIETEYGLTFVDGDSKKLRPDEIARRMFRPIVEKYSSSNIFIPNGSRLYLDVGSHPEYATAECDNLTQLINFEKAGDVIADRMAVDAEESLAKEDIAGQVYLFKNNVDSVGNSYGCHENYLVGRSMPLKALGKRLMPFLITRQLICGAGRIHHPNPLDKGESFPLGYCISQRSDHVWEGVSSATTRSRPIINTRDEPHADSHSYRRLHVIVGDANMAEPSIALKVGSTLLVLEMIEADFGLPSLELANDIASIREISRDATGSTLLSLKDGTTMTALQIQQVVFEHASKWLEQRPEPEFSGTSNTEMARVLDLWGRMLKAIESGDFSEVDTEIDWVIKKKLIDRFIQRGNLGLDDPKLAQVDLTYHDIRPGRGLFSVLQSRGMIKRWTTDEAILAAVDTAPDTTRAHLRGRILKAADTLGVPVTVDWMRHKVNRPEPQSVELGDPFSAVNSEVDQLIEYMTVHAESYRS

pafA

Pup--protein ligase

482 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

53.801 kDa

MSTVESALTRRIMGIETEYGLTFVDGDSKKLRPDEIARRMFRPIVEKYSSSNIFIPNGSRLYLDVGSHPEYATAECDNLTQLINFEKAGDVIADRMAVDAEESLAKEDIAGQVYLFKNNVDSVGNSYGCHENYLVGRSMPLKALGKRLMPFLITRQLICGAGRIHHPNPLDKGESFPLGYCISQRSDHVWEGVSSATTRSRPIINTRDEPHADSHSYRRLHVIVGDANMAEPSIALKVGSTLLVLEMIEADFGLPSLELANDIASIREISRDATGSTLLSLKDGTTMTALQIQQVVFEHASKWLEQRPEPEFSGTSNTEMARVLDLWGRMLKAIESGDFSEVDTEIDWVIKKKLIDRFIQRGNLGLDDPKLAQVDLTYHDIRPGRGLFSVLQSRGMIKRWTTDEAILAAVDTAPDTTRAHLRGRILKAADTLGVPVTVDWMRHKVNRPEPQSVELGDPFSAVNSEVDQLIEYMTVHAESYRS

pafA

Pup--protein ligase

479 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

53.46 kDa

MGEYERTVFTRRITGVETEYGITCVGDNSRRRLGADEAARYMFRPVVEEWGSSNVFIPNGARLYLDVGSHPEYASAECDSLSQLIAYDRAGDKIVDQLAQRAETALATEGIGGRVYLFKNNLDSLGNSYGCHENYLVSRDVVLKTLGRQLLPFLITRQLICGAGSIQDGQFQVSQRADHVWEGVSSATTRSRPIINTRDEPHADSHRFRRLHVIVGDSNMSETTCALKIGSTQLVLEMIEAGALSHDLELSNEIAAIREISRDITGMAPVPLKAGTSMPAIEIQRRYAEKALCWLEQRGDTEGTPNAEMHKVVSLWLDTISAIESNDLQALSRDIDWAIKLSLLRRAQRRIGCSESDFTHPKLAQLDLAYHDIRAGRGVFPVLESKQLVNRWINDTDIEQATRIAPSTTRAALRGEFLTAAKKLQAPISADWLRLKVNRPEPQIIELTDPFENTDDRVDQLISYMRNHAASYSTDTAIS

pafA

Pup--protein ligase

477 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

53.56 kDa

MSADKAVFTRRIMGIETEFGITCTHDGAQAVAPDDIARQLFRPIVDRFRSSNIYTLNGGRLYLDVGSHPEYATPECDSLNQLLIYDRAGEVTLNRLADQAEHALADQHIEGTVHLMKNNTDSLGNSYGCHENYLVGRAILLKKLGQEFIPFLITRQLICGAGHIARPHSRFSDGDTTPVYQLSQRADHVWEGVSSATTRSRPIINTRDEPHADSEMYRRLHVIVGDSSMSETTAALKIGSALLVLEMLEAGCSFDEWEIANPSKTIRDISRDLTGRAEVPLRSGRISCALEIQQAFAEKAQQWLDERPEEQHGTPNADMQRVVDLWKKVLAAIDSGDTSSIEADIDWVIKKNIIDRYQDKFGWDLTHPKLQQIDYAYHDIRPGKGIFRTLEERGRVSRWLDGADSSITDAADTPPQTTRAKMRGDFLRVAQENDADVSVDWTRLKINRPEPHDIALLDPFAAHDSRADDMISSILDR

pafA

Pup--protein ligase

475 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.9 kDa

MEQPSDSAPVYARRIMGIETEYGITASASNGQRVMSPDEIARVLFRPIVSKYSSSNIFSPNASRLYLDVGSHPEIATAECDSLSQLIAYERAGDAMVNRMAVQAEETLADEGEKRAVYLFKNNVDSAGNSYGCHENYLIGRHVVLKDLGKALLPFMITRQLICGVGMIRPAKGDDPACFVLSQRADQVWEGVSSATTRSRPIINTRDEPHGDSKRFRRMHVIVGDSNMAEPTMALKVGSTLLMLEMLEAGFEVPNLSVLEPIQHIRAIALDPTGRTELPLEGGGSTTALAVQQELCTAAERWLEHREEAGTPTTELARVVDLWKRTLQAIDTQDFSSVDREIDWVIKRSLLNRYRDRLGGDWAHPKLAQIDLTYHDIRPGRGLYSVLEQRGMVERWIDDAAIDAAIDTAPQTTRAKLRGEFLAVARELDAAVTVDWTRMKVNRPEPMTEEFSDPFVSEDPRLDGLLDYMRSHPGS

pafA

Pup--protein ligase

473 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.118 kDa

MKRRVGGLETEYGLVCVRADGSRALEPEAAARELFRPVVAMGRSSNVFLRNAARLYLDVGSHPEYATAECDDWWELVAQDRAGDRMFAELAAEATERLAADGQDARIHLLKNNVDSAGNAFGSHENYLVDRRGEFTRLPRYLLPFLVTRQIVTGAGGVVRPAPADGAPEQEAGPAQFVFSRRSDHMWEAVSSATTRTRPIINTRDEPHGDPTRFRRLHVIVGDSTMSEVSTHLRFATTDLVLRAIESGRALPELALHDDIAAIRAVARDLTGTTAIPTADGGTTTAIEVQQRWLDHVTEFADESEQDVLETWQRGIDAVRTGDRSWAATHLDWAIKERLFHQVAERRGVDLGDPAIERLDLAYHDIDPTQSVFAALQRRGLAPQVLDEQRIERARTTAPTTTRAHLRGQVVTAAQEHGVDHVVDWTTLRLTRPGAMPVQVLDPFATELPAVDALLEEIRASAAGAPESPPPFA

pafA

Pup--protein ligase

469 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.223 kDa

MDRRIYGIETEFGLTHSAPEGPALSADDAARRLFAPVLAWGRASNVFLPNGGRLYLDVGSHPEYATAEAATLHDVVAQDAAGERIVDELRSRLQESLDAEGVRGTVHLFKNNVDSAGNAFGSHENYMIARSTEFSRLLGHLLPFLVTRQILVGAGKVHPSGPPAFGAFAPGDGAASYSFSQRADHIWEGSSSATTRSRPMINTRDEPHADAQHYRRLHVITGDSNMSQTTTALKIGATDLLLRMIEAGQILPDRTLADPASALRQVSHDLTGTARLALADGSSRTALELQHEVLEAVTRFVQRHGAHHDRVPWVLELWERGLRAVAEQNASLVDRELDWAVKKKLLDAYAASHGMDLSHPRLAQLDLAYHDTSPTHGLFHMLERRGAVESFVSPQDVSRAVGQAPETRARLRGRFVAAAHAADVNHTVDWVHLKLNGPHSQRISMCKDPFATTQPDVEEMIRDLAAGAV

pafA

Pup--protein ligase

467 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.656 kDa

MTAIRRRIMGLETEYGIANMQDSSRRLGPDEIARKLFAPVVEKHRSSNIYTENASRLYLDVGAHPEFATAECDSLHQLIAYDRSGDLMFHELADRAEQAVGGKVYLLKNNTDSLGNSYGCHENYLVSRDIPLKGLSKQLLPFLVTRQLICGAGKLAIPYPGAPNENFGPGYTMSQRADHVWEGVSSATTRSRPIINTRDEPHADSSKYRRLHVIVGDSNMSEVTTALKVGSTLLVLEMIEAGVALPDFEMANEIRSIREISRDFTGQVDIALRSGSTATPLEIQRAFYDAACAYLASREDPERGTPNAELTPVVDLWGRVLDCFDTGDFSPVSTEIDWVIKKSLLDRMAAARGLDPIDPRLAQIDLMYHDIHPTRGLFNVLARRGLARTLLAPETIEQAVRQAPPTTRAAVRGRFIAAVRANPELSYTVDWMRVKVNGEGGAEALLADPFANTSEDVDRIIESLESR

pafA

Pup--protein ligase

464 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.898 kDa

MTDADRARRIFGLETEYGVQHWNPEGRPLSPEEVVRYLFRPVVEWGRSSNVFVANGSRLYLDVGSHPEYATAECSTLDELIASDGAGDLLLHDLVVQAEERMAADGVGGRIHLYRNNADSSGSSYGSHENYLLRRRTEYRRLTEALVPFLVSRQILVGAGRVVPAGTWPEGEGPAHFAFSQRADFVQDGVSSSTTRSRPIINTRDEPHADASEYRRLHVIVGDTNLSEHTHLLRFGATDLLLRMIEAGFPLGDRVVAHPTRAVRQISHDLTGTARIALREGEASALELQEHYLERARAFVAAEGAHHDRVGEILTLWGEVLDAVRTGDRSRIEDRIDWAIKLRLLEDYRARHDLGWDAPRLAQLDLAFHDIDPDRGLFRLLLRRGAVARLLPEDAARSAVETAPPTTRARVRADFVARARERGLDYAVDWTTLKLTDHPLHAIVTKDPFDTSSAAVDRLFGRIA

pafA

Pup--protein ligase

461 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.672 kDa

MDRRIFGIETEFGITFSSKDSRPLSPEEVARYLFRRVVSWGRSSNVFLANGSRLYLDVGSHPEYATAECDEIGQLIAHDRAGELILNELVAEAEKRLNLEGFAGSVYLFKNNTDSAGNSYGSHENYLIGRRGEFARLAEILIPFLVTRQLIAGAGKVHQNAGQANYSFSQRAEHIWEGISSATTRSRPIINTRDEPHADAELYRRLHVIVGDSNMSETTTMLKVGTIDLILRMVEDGVIMRDLRMENPIRSIREISQDLTGMAPVKLANGRVTNALEIQREYFEKVSEYLLTAGAHHALVPRIMDLWQRTLNAIEQQDFSSIETEIDWAIKKKLLDAYQAKNSLTLNSPRLAQIDLAYHDIATDRGLYYLLQKRGAVARVNEDGQAMAAIEAPPATTRAALRGKFVKAAQSAGRDYTVDWVHLKLNDQAHQTVLCKDPFRNTDERVDALIASLGTESDFSD

pafA

Pup--protein ligase

459 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.77 kDa

MTRRIFGLETEYGITYAHPTDDVTLSADEVARQLFKKVVAWGRSSNVFLRNGSRLYLDVGSHPEYATAECDSVEQLIAHDRGGELILVDLIDDAQRRLAQEGYTGTIHLLKNNTDSAGNSYGCHENYLVRRQGDFTRLADILIPFLITRQVVVGAGKIMSTPQGPRYCFSQRADHMWEAVSSATTRSRPIINTRDEPHADAEFYRRLHVIVGDSNIAEPTTFLKVGATDMVLRLIEAGVPMRDLALDNAMRAIREISHDITGRATVTLSSGKTVTAWQLQEMYVEKVRTYVESLGPLSPTDEAVFELWERALRAVETQDHSLIDRDIDWAIKKRLLDRTQDRLGCALDDPRLARLDLAYHDISPATGLGHRLVSRSMMNRVVSDAEVERASQVAPETTRAHLRGRFVTAAQEQKKDYTVDWVHLKLNDQAQRTVLCKDPFAHVDDRVDQLIDSMRTQAT

pafA

Pup--protein ligase

457 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.361 kDa

MDRRIFGIETEYGVTCAAPDGRGLSADEVARYLFRKVVAWGRSSNVFLRNGSRLYLDVGSHPEYATAECDDVRQLVTYDKGGERILEGLVADAQQRLEHEGLPGTVHLFKNNTDSAGNSYGCHENYLVRRQGDFARLSDILVPFLITRQVLVGAGKVLATPRGAVYCLSQRADHIWEAVSSATTRSRPIINTRDEPHADAEYFRRLHVIVGDSSMAEPTTMLKVGATDLVLRLVEAGVIMRDLSLENPIRAIREISHDRTGTHAVQLADGRTMTAVDIQGEYFRRVREHVDAHGINDADPSPTTKAVLDLWERGLHALESGDLSSVDRELDWVIKLRLIERYQAKHGLELDDPRIARLDLAYHDISRTEGLYNLLAARGMVERVTTDLEILESTAVPPPTTRAKLRGDFVRAAQDARRDYTVDWVHLKLNDQAQRTVLCKDPFRSVDERVDRLIESM

pafA

Pup--protein ligase

455 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.008 kDa

MPRLARRIYGIENEYGITCTQRGQRRLSPDEVARYLFRRVVSWGRSSNVFLENGARLYLDVGSHPEYATPECDSLSDLVAHDKAGERILESLAHSAEAKMREEGIRGDVFLLKNNTDSAGNSYGCHENYLTVRVDDLTRLVEVLIPFLVSRQIIAGAGKVLLTSRGPLYAVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSQWATYLKVGAMAIVLRLLEEEVVLRDLTLENPIRAIREIAHDTELERTVRLVNGRELTGLEIQEAYFERAERYHERIGLPADEARALDMWREALKALRANDHEALFGKVDWVTKLTLIEAFRARHQLPLSHPQVSLLDLQYHDISRERGLFARLEAKGRVPRIVDDETIERAVDEPPATTRAALRGRFIRAAKEAHRDYTVDWVHLKLNDQAQRTVMLKDPFASEDERVDRLLTSI

pafA

Pup--protein ligase

455 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.27 kDa

MSTRRIFGLETEYGITCAAPPGQQGLSADEVARYLFRKVVAWGRSSNVFLRNGSRLYLDVGSHPEYATAECDDIRQLITYDRGGERILEGLVADAQQRLELEGVPGTIHLFKNNTDSAGNSYGCHENYLVRRQGDFTRLADILVPFLITRQVLTGAGKILTTPAGATFCLSQRADHIWESVSSATTRSRPIINTRDEPHADAELYRRLHVIVGDSSMAEPTAMLKVGATDMVLRMIEAGVPMRDMALENPMRAIREISHDMTGKAPITLASGRTVTAVDLQQEYLVKVRDFVESTGEVSDTDRKVFDLWERGLLALQSGDLTSVERELDWVIKHRLVRRYQEKHSLELSDPRIARLDLAYHDISRTEGLYNLLAARGLVERVTSDVEVLESTAVPPQTTRARLRGEFVRRAQEAKRDYTVDWVHLKLNDQAQRTVLCKDPFQSVDERVDRLIESM

pafA

Pup--protein ligase

454 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.248 kDa

MDKRIFGIETEFGISYSSPDSRPLAPEEVARYLFRKVVSWGRSSNVFLTNGSRLYLDVGSHPEYATAECDDLGQLIAHDRAGELILDDLVDEAQERLAAEGFNGTVYLFKNNTDSAGNSYGSHENYLIPRRGEFSRLAEILIPFLVTRQLIAGAGKILKTPHGATFAFSQRADHIWEGVSSATTRSRPIINTRDEPHADAEFYRRLHVIVGDSNMSETTALMKVGTVDLILRMIEAGVIMRDMRMENPIRSIREISHDLSGRALIRLANGRQLTALEIQREYLNKVTSFVAENGAHNQHVPLILDLWERTLTAIESGDTSTIDTEIDWAIKKKLMDSYRKRHGLGLDAPRIAQLDLTYHDISRTRGLYYLLQSRGAVRRVVDDTAVKDAVDAPPQTTRAKLRGDFVRRAQELGRDYTVDWVHLKLNDRAHQTILCKDPFRNVDERVDALLDSMG

pafA

Pup--protein ligase

454 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.205 kDa

MDRRIFGLENEYGVTCVFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLKNGARLYLDVGSHPEYATPECDSVPDLVTHDKAGERILEGLLVEAERRLREEGIAGDIHLFKNNTDSAGNSYGCHENYLVGRHGEFSKLADVLVPFLVSRQILCGAGKVLQTPRGAVYCISQRAEHIWESVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTMLLKLGATDLVLRMIEAGVMLRDMTLENPIRAIREVSHDMTCQRRIKLANGREVSALDIQWEYHSKAVEFVERRGGDGDEVAKRVLDLWGRTLLAIETDDLELVAREIDWVTKYVLIERFRHKHGLSLASPRVAELDLKYHDIHRDRGLYYRMERAGLVERVTRDLDVFEAKSRPPQTTRARLRGEFIKRAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDDRVDKLIASM

pafA

Pup--protein ligase

454 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.202 kDa

MDKRIFGIETEFGISYSSPDSRPLAPEEVARYLFRKVVSWGRSSNVFLTNGSRLYLDVGSHPEYATAECDDLAQLIAHDRAGELILDDLVDEAQARLAAEGFNGTVYLFKNNTDSAGNSYGSHENYLIPRRGEFSRLAEILIPFLVTRQLIAGAGKVLKTPHGATFAFSQRADHIWEGVSSATTRSRPIINTRDEPHADAEFYRRLHVIVGDSNMSETSALLKVGTVDLILRMIEAGVIMRDMRMENPIRSIREISHDLTGRALVRLANGRQLTALDIQREYLNKVTDFVATNGAHNAHVPLILDLWQRTLDAIESGDTSTIDTEVDWAIKKKLMDGYMRRHDLSLDSPRIAQLDLTYHDISRQRGIFFLLQARGQARRLVTETDVKDAVDAPPQTTRAKLRGDFVRRAQELGRDYTVDWVHLKLNDRAHQTILCKDPFRSVDERVDALLDSMG

pafA

Pup--protein ligase

454 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.287 kDa

MDKRIFGIETEFGISYSSPDSRPLAPEEVARYLFRKVVSWGRSSNVFLTNGSRLYLDVGSHPEYATAECDDLAQLIAHDRAGELILDDLVDEAQARLAAEGFNGTVYLFKNNTDSAGNSYGSHENYLIPRRGEFSRLAEILIPFLVTRQLIAGAGKILKTPHGATYAFSQRADHIWEGVSSATTRSRPIINTRDEPHADAEFYRRLHVIVGDSNMSETTALMKVGTVDLVLRMIEAGVIMRDMRMENPIRSIREISHDLSGRALVRLANGRQLTALEIQQEYLTKVTAFVRENGAHNPHVPLILDLWERTLKAIESGDTRSIDTEIDWAIKKKLMDSYRERHGLGLDAPRIAQLDLTYHDISRSRGLYYLLQSRGAVRRLVDDTVIKDAVDAPPQTTRAKLRGDFVRRAQELGRDYTVDWVHLKLNDRAHQTILCKDPFRSVDERVDALLDSMG

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.172 kDa

MDRRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNVTELVTHDKAGERILEGLLVDAERRLHEEGIAGDVYLFKNNTDSAGNSYGCHENYLVARHGEFSRLADILIPFLVTRQLLCGAGKVLQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLTLENPIRAIREVSHDITGRRKVRLASGREASALEVQREYYEKAVDFCERRGIRTGTVEQVLELWGRTLDAIEAEDLDRIGTEIDWVMKYKLIERYRAKHNMTMSHPRVAQIDLAYHDIHRRRGLYYLLEKRGQATRICNDLKIFEGKSVPPQTTRARLRGDFIRRAQEQRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDDRVEKLIAGM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.096 kDa

MDRRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNVTELVTHDKAGERILEGLLVDAERRLHEEGIAGDVYLFKNNTDSAGNSYGCHENYLVARHGEFSRLADILIPFLVTRQLLCGAGKVLQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLTLENPIRAIREVSHDITGRRKVRLASGREASALEVQREYYEKAVDFCERRGIRTGTVERVLELWGRTLDAIEAEDLDRIGTEIDWVMKYKLLERYRAKHNMTMSHPRVAQIDLAYHDIHRRRGLYYLLEKKGQAARVANDLKIFEGKSVPPQTTRARLRGDFIRRAQEQRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDDRVEKLIAGM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.144 kDa

MDRRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNVTELVTHDKAGERILEGLLVDAERRLHEEGIAGDVYLFKNNTDSAGNSYGCHENYLVARHGEFSRLADILIPFLVTRQLICGAGKVLQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLTLENPIRAIREVSHDLTGQRKVRLASGREASAIEVQREYYEKAVDFVERRGIRTGTVDQVLELWGRTLDAVEAQDLDRIDTEIDWVMKYKLIERYRAKHNMTMSNPRVAQIDLAYHDIHRRRGLFYLLERKGQTARICNDLKIFEGKSVPPQTTRARLRGDFIRRAQEQRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVEKLIAGM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.168 kDa

MDRRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNVTELVTHDKAGERILEGLLVDAERRLHEEGIAGDVYLFKNNTDSAGNSYGCHENYLVARHGEFSRLADILIPFLVTRQLLCGAGKVLQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLTLENPIRAIREVSHDITGRRKVRLASGREASALEVQREYYEKAVDFVERRGIRTGTVEQVLELWGRTLDAIEAEDLDRIGTEIDWVMKYKLIERYRAKHNMTMSHPRVAQIDLAYHDIHRRRGLYYLLERKGQATRICNDLKIFEGKSVPPQTTRARLRGDFIRRAQEQRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDDRVEKLIAGM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.89 kDa

MDRRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDSVRELIVHDKAGERILEGLLADAERRLHEEGIAGDVYLFKNNTDSAGNSYGCHENYLVGRHGEFSRLADVLIPFLVTRQLICGAGKVLATPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTTLRDMTLENPIRAIREVSHDMTGQKKVRLANGREMSALEIQEEYFTKARDFAEKRGLRTGAVDRILDLWERTLTAVNTGDLDLISREIDWVIKYQLIERYRAKNNLAMSAPRVAQLDLAYHDISRNRGLYYLLEKRGMVERTATDLEIFQAKSVPPQTTRARLRGEFIKRAQEQRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVEKLISSM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.774 kDa

MDRRIFGLETEFGVTCAFEGQRKLSPDEVARYLFRKVVSWGRSSNVFLKNGARLYLDVGSHPEYATPECDDVRQLVVHDRAGERTLEGLLTDAERRLEEEGIAGEVFLFKNNTDSAGNSYGCHENYLVSRHGEFGKLSDVLIPFLVSRQLIVGAGKVVQTPRGAVYSLSQRADHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTTMLKLGATDLVLRMVEEGVVLREMTMENPIRAIREISHDMTGRKPVRLANGREASALEIQEEYLEKAKEFVESRGLQTPTIKRVLDLWERALRAVATQDFSLVDREVDWVIKKKLLDRYMAKHDLPLTSPRIARLDLAYHDIHRKRGLHYMLAERGMAERVCSDIEVFEALSVPPQTTRAKLRGDFVRAAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFKAVDDRVERLIDSM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.939 kDa

MDRRIFGIENEYGVTCTFKGQRRLSPDEVARYLFRKVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDDVVELVTHDKAGERVLEGLLLDAEQRLHDEGIAGEIYLFKNNTDSAGNSYGCHENYLVSRAGEFSRLADVLIPFLVTRQIIVGAGKITQTPRGASYSVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVASCDLVLRMIEEGVVMRDLTMENPIRAIREISHDVTGRRKVRLANGREASALDIQQEYLTKARDFVDRRELSTPLIEQALDLWERGLKAVEADDLGLVDREIDWVIKWKLIERYRAKHGLPLGHPRIAQLDLAYHDIHRGRGLYYLLEKRGAVARVTTDLKIFEAKSVPPQTTRARLRGEFIRRAQERRRDFTVDWVHLKLNDQAQRTVLCKDPFRAHDERVQRLIDGM

pafA

Pup--protein ligase

453 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.771 kDa

MNRRIFGLENEYGVTCTFRGQRRLTPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATGECDSVTDLIAHDKAGERILEGLLVDAQKRLHDEGIFGDVYLFKNNTDSAGNSYGCHENYLVSRHGDFAKLADVLIPFLVTRQLICGAGKVLQTPRGAVYSVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTMLLKVASTDLVLRMIEAGIVMRDLTLDNPIRAIREISHDMTGRREVRLANGREASALDIQGEYLSKARDFVDRRELGTPAVERALSLWERTLKAIESGDLSGIEREIDWVIKYRLIERYRAQNNLGLASPRVAQLDLAYHDIHRPRGLYYLLERKGAVTRVVDDLRVFEAKSVPPQTTRARLRGEFIKRAQERRRDFTVDWVHLKLNDQAQRTVLCKDPFKSHDERVEKLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.854 kDa

MDRRIFGLENEYGVTCTFHGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNLVDLVVHDKAGERTLEGLLVDAEHRLREEGITGDIYLFKNNTDSAGNSYGCHENYLVTRQGEFSRLADVLIPFLVTRQLICGAGKVLATPRGAVYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMAEPSTLLKVGSTDIVLRMIEAGVVLRDLSLENPIRAIREVSHDPTGRRRIRMANGREASALEIQEEYLSKAQEFLERRGTDAVTKRVLDLWERTLRAVRTGDLSLVDREIDWVIKYRLIEAYRARHDLPLSSPRVAQIDLAYHDVKRTRGLYYLLERKGAVERVAHDVQIFEAKSTPPQTTRARLRGEFIRHAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVEKLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.144 kDa

MQRRIFGIETEFGVTCTFHGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGSRLYLDVGSHPEYATAECDDLAQLVSHDKAGERILEDLLVDAERRLADEGIGGDIFLFKNNTDSAGNSYGCHENYLVARAGEFSRIADVLLPFLVTRQLICGAGKVLQTPRGAVYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSEVTTLLKVGSANLVLEMIEQGVQFRDFSLDNPIRAIREISHDLTGRRTVKLAGGKEASALDIQREYYERAVEHVAKRSPDPMAERVLELWGRTLDAIAAQDLSKIDREIDWAIKHRLLERYQAKHDMDLSNPRIAQLDLAYHDIRRGRGVFDLLQRKGQVERVTDDGEIEAAKDTPPQTTRAKLRGDFIAAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVERLIASL

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.89 kDa

MDRRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNVVELVTHDKAGERILEGLLVDAEKRLREEGIAGDIYLFKNNTDSAGNSYGCHENYLVGRHGEFGRLADVLIPFLVTRQIVCGAGKVLQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLSLENPIRAIREVSHDMTGRRRVRLANGREASSLEIQQEYLSKARDFVDRRGGDEISHRVLELWERTLNAVETGNLDLVAREIDWVTKYQLIERYRKKYDLPLSSPRVAQLDLAYHDVHRRRGLFYLLQKRGAVERVASDLKIFEAKSVPPQTTRARLRGEFIRKAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVDKLIAGM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.937 kDa

MERRIFGLENEYGVTCVFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDSVIDLVTHDKAGERILEGLLVDAERRLREEGIAGDIYLFKNNTDSAGNSYGCHENYLVGRHGEFGRLADVLIPYLVTRQIICGAGKVLQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGVVMRDLTLENPIRAIREVSHDMTGRRKVRLANGREASSLDIQKEYYGKAKDFIDRRGGDAVAHRVLDLWERTLRAVETGDLDLVAREIDWVTKYQLIERYRRKYDLPLSSPRVAQLDLAYHDVHRGRGLYYLLERRGSVERVTNDLRIFEAKSVPPQTTRARLRGEFIRRAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVDKLIAGM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.875 kDa

MERRIFGLENEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDNLLDLVAHDKAGERILEGLQIDAEQRLREEGIAGDIYLFKNNTDSAGNSYGCHENYLVARHGEFGKLADVLIPFLVTRQIICGAGKVLQTPRGALYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTTLLKLASTDLVLRMIEANVPMRDFTLENPIRAIREISHDMTGRRKVRLANGREASALEIQREYLERVQSFVDRTGTDATGKRVLELWQRTLEAVESGNLDLVAREIDWVAKYKLLERYRAKHGLSLSSPRVAQLDLTYHDIHRDRGLFYLLQQRGQMERVVSDLRIFEAKSVPPQTTRARLRGEFIKKAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFKAVDERVEKLIAGM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

52.016 kDa

MDRRIFGLENEYGVTCVFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLKNGARLYLDVGSHPEYATPECDSVPDLVTHDKAGERILEGLLVEAERRLREEGIAGDIHLFKNNTDSAGNSYGCHENYLVGRHGEFSKLADVLVPFLVSRQILCGAGKVLQTPRGAVYCISQRAEHIWESVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTMLLKLGSTDLVLRMIEAGVMLRDMTLENPIRAIREVSHDMTCQRKIKLANGREVSALDIQREYYSKAVEFVERRGGDEVAKRVLDLWGRTLLAIETDDLELVAREIDWVTKYVLIERFRHKHGLSLASPRVAELDLKYHDIHRDRGLYYRMERAGLVERVTRDLDVFEAKSRPPQTTRARLRGEFIKRAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDDRVDKLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.885 kDa

MDRRIFGLENEYGVTCVFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLKNGARLYLDVGSHPEYATPECDSVPDLVTHDKAGERILEGLLVEAERRLREEGIAGDIHLFKNNTDSAGNSYGCHENYLVGRHGEFSRLADVLVPFLVSRQILCGAGKVLQTPRGAVYCISQRAEHIWESVSSATTRSRPIINTRDEPHADAERFRRLHVIVGDSNMSETTMLLKLGSTDLVLRMIEAGVVLRDMSLENPIRAIREVSHDMTCQRRIKLANGREVSALDIQREYYSKAVEFVERRGGDAVAKRVLDLWGRTLLAIETEDLELVAREIDWVTKFVLIDRFRLKHGLSLASPRVAELDLKYHDIHRDRGLYYRMERAGLVERVTRDLDIFEAKSVPPQTTRARLRGEFIKRAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDDRVDKLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.922 kDa

MERRIFGIETEYGVTCTFRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGSRLYLDVGSHPEYATAECDDLSELVVHDKAGERILEGLLVDAEQRLAEEGVTGDIYLFKNNTDSAGNSYGCHENYLVGRHGEFSRLADVLIPFLVSRQIVVGAGKVLQTPRGAIYCISQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMNETTTLLKVAVTDLVLRMIEAGVPIRDMTLENPIRAIREISHDMTGRRKVRLANGKEMSALEIQSEYHSRAAEFVDREGFGPVHRQMLELWGRVLKAVDTGDLSLIDREIDWATKYQLIERYRAKRDLPMSSPRIAQMDLAYHDISRTRGLYYLLERNNQVDRVAHEPRVFEAKNVPPQTTRARLRGEFIRRAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFKAVDERVDKLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.086 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLQNGARLYLDVGSHPEYATAECDSLIQLINHDRAGELVLEDLLVDAEQRLSDEGIGGDIYLFKNNTDSAGNSYGCHENYLVVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSEMTTLLKVGSAALVLEMIEAGVVFRDFALDNPIRAIREASHDPTGRRPVRLAGGRQASALDIQREYHARAVEHMTNRRPDPEMDMVVDLWGRMLDAVERDDFSKVDTEVDWVIKRKLFQRYQDKYSMELSDPKIAQLDLAFHDIKRGRGVFDVLSRKGLVTRATTDEAIATAVNEPPQTTRAKLRGDFISAAQKAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVDRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine. PafA is required to confer resistance against the lethal effects of reactive nitrogen intermediates (RNI), antimicrobial molecules produced by activated macrophages and other cell types.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine. PafA is required to confer resistance against the lethal effects of reactive nitrogen intermediates (RNI), antimicrobial molecules produced by activated macrophages and other cell types.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.289 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTASLVLEMIEAGVPFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQVEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLATRVTTDEEIADAVDNPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.319 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLTQLVTHDRAGERVLEDLLIDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSESTTMLKVGSASLVLEMIEAGVAFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYARAVEYLQTREPNTQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDLAYHDIKRGRGVFDLLQRKGLAARITTDEEIEAAVNTPPQTTRAKLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

50.335 kDa

MQRRIMGIETEFGITCTFHGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGSRLYLDVGSHPEYATAECDELPVLIAHDKAGERILQDLVVDAETRLAEEGIGGDIYLFKNNTDSAGNSYGCHENFLIARGGEFAKIADGLIPFLVTRQLIAGAGKVLQSPRGASYCLSQRADHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTTLLKVGTAALVLEMIESGVPMRDFTFENPIRAIREISHDTTGRKAVRLAGGGDISALDAQTEYYEKAAAFVANRGTDPVTHQVLDLWRRTLEAVQTQDFTKVDTEIDWIIKKKLIDAYAAKHGLDLTHPRIAQLDLTYHDVRPGRGLHSLLAARGRAARVVTDGQITTAMTVPPQTTRARLRGEFVAAAQDAGRDYTVDWVHLKLNDQAQRTVLLKDPFRSTDDRVTKLIEAM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.291 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLHQLVTHDRAGERVLEELLIDAEQRLAEEGIGGDIYLFKNNTDSAGNSYGCHENFLVVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIEAGVAFRDFALDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYARAVEHLRNRDRDPQIDQVVDLWGRALDAVEAQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAKRITEDEAVDAAVDTPPQTTRAKLRGDFITAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVDRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.031 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLIQLVNHDRAGERVLEELLIDAEARLAEEGIGGDIYLFKNNTDSAGNSYGCHENFLVARAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMAETTTMLKVGSAALVLEMIEAGVSFRDFALDNPIRAIREVSHDVTGKKPVRLAGGRQASALDIQREYHAKAVEHLRNREPDPQVEQVVDLWGRTLDAVEAQDFAKVDTEIDWVIKRKLFQRYQDRHGFDLSDPKIAQLDLAYHDIKRGRGVFDVLQRKGLVKRVTEDETIDDAVENPPQTTRAKLRGDFITAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.232 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLIQLVNHDRAGERVLEELLIDAEQRLAEEGIGGDIYLFKNNTDSAGNSYGCHENFLVARAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSESTTMLKVGTAALVLEMIEAGVSFRDFALDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYHARAVEHLQNRDPDPQVTQVVDLWGRMLDAVETQDFAKVDTEIDWVIKRKLFQRYQDRHGFELADPKIAQLDLAYHDIKRGRGVFDVLQRKGLVKRITEDETIEAAVDTPPQTTRAKLRGEFITAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.232 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLIQLVNHDRAGERVLEELLIDAEQRLAEEGIGGDIYLFKNNTDSAGNSYGCHENFLVARAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSESTTMLKVGTAALVLEMIEAGVSFRDFALDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYHARAVEHLQNRDPDPQVTQVVDLWGRMLDAVETQDFAKVDTEIDWVIKRKLFQRYQDRHGFELADPKIAQLDLAYHDIKRGRGVFDVLQRKGLVKRITEDETIEAAVDTPPQTTRAKLRGEFITAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.254 kDa

MQRRIFGIETEFGVTCTFHGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDDLVQLVTHDKAGERILEDLLIDAERRLSDEGIGGDIFLFKNNTDSAGNSYGCHENYLVGRSGEFSRIADVLLPFLVTRQLICGAGKVLQTPRGAVYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSEVTTLLKVGAANLVLEMVEQGVQFRDFSLDNPIRAIREISHDLTGRRTVRLAGGREASALDIQREYYGRAVDHVARRGSDPMSERILDLWGRALDAVEHQDYSLIDREVDWAIKLRLLERYRNKHGLELSSPRIAQLDLAYHDIRRGRGLFDMLQRKDLVDRATEDGEIEAAKDTPPQSTRAKLRGDFIAAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVERLISSL

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.296 kDa

MQRRIFGIETEFGVTCTFHGQRRLSPDEVARYLFRRVVSWGRSSNVFLSNGSRLYLDVGSHPEYATAECDDLAQLVTHDKAGERILEDLLIDAERRLAEEGIGGDIFLFKNNTDSAGNSYGCHENYLVTRAGEFSRVADVLLPFLVTRQLVCGAGKVLQTPRGGVYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMAEPTTLLKVGSVHLVLQMIEEGVQFRDFTLDNPIRAIREISHDLTGRRQVRLAGGREASALEIQREYYARAVQHVESGDPSPTTQYLIDLWGRALDAVEQQDFSSIDTEIDWAIKHRLVERYRSKHNLTLSDPRVAQLDLAYHDIRRGRGVFDLLQRKGMVRRITDDGEIELAKDSPPQTTRAKLRGDFIAAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLINSL

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.648 kDa

MERRIFGLETEYGVTCTYRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDSVADLVAHDRAGERILEGLLVDAEKRLHDEGIAGEIYLFKNNTDSAGNSYGCHENYLVSRHGEFGRLADVLIPFLVTRQLICGAGKVLQTPRGAVYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMNEVTTLLKVGAADIVLRMIESGVVMRDLTLENPIRAIREVSHDITGRRKVRLASGKEISALEIQQEYLAKATEFVERRGGDQTAKRVVELWGRVLRAVETGDLDPVAREIDWVTKLRLIERYQGKHDLPLSHPRVAQMDLAYHDLRRGRGLYGLLERRGQVDRAATDPEIFEAKETPPQTTRARLRGEFIRHAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRAYDERVERLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.692 kDa

MERRIFGLETEYGVTCTYRGQRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATPECDSVADLVAHDRAGERILEGLLVDAEKRLHDEGIAGEIYLFKNNTDSAGNSYGCHENYLVSRHGEFGRLADVLIPFLVTRQLICGAGKVLQTPRGAVYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMNEVTTLLKVGAADIVLRMIESGVVMRDLTLENPIRAIREVSHDITGRRKVRLASGKEISALEIQQEYLAKATEFVERRGGDQTAKRVVELWGRVLSAVETGDLEPVAREIDWVTKLRLIERYQRKHDLPLSHPRVAQMDLAYHDLRRGRGLYGLLERRGQVDRAATDPEIFEAKETPPQTTRARLRGEFIRHAQEKRRDFTVDWVHLKLNDQAQRTVLCKDPFRAYDERVERLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.299 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTAALVLEMIEAGVPFRDFSLDNPIRAIREVSHDITGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQIEQIVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIAEAVDTPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.296 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGERVLEDLLVDAEQRLSDEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMAETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYHARAVEHLNTREPNEQVEQVVELWGRTLDAVESQDFSKVDTEIDWVIKRKLFQRYQDRYNMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEEIKAAVDQPPQTTRAKLRGDFITAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.317 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLIQLVTHDRAGERVLEDLLIDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSESTTMLKVGSASLVLEMIEAGVAFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYARAVEYLQSREPNTQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDLAYHDIKRGRGVFDLLQRKGLAARITTDEEIEAAVNTPPQTTRAKLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.458 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTAALMLEMVETGVPFRDFSLDNPIRAIREVSHDITGRRPVRLAGGRQASALDIQREYYTRAFEHLQTREPNVQFEQVVDLWGRQLDAIESQDFAKVDTEIDWVIKRKLFQRYQDRDNMELTDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIADAVNHPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.458 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTAALMLEMVETGVPFRDFSLDNPIRAIREVSHDITGRRPVRLAGGRQASALDIQREYYTRAFEHLQTREPNVQFEQVVDLWGRQLDAIESQDFAKVDTEIDWVIKRKLFQRYQDRDNMELTDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIADAVNHPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.289 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTASLVLEMIEAGVPFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQVEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLATRVTTDEEIADAVDNPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.299 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTAALVLEMIEAGVPFRDFSLDNPIRAIREVSHDITGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQIEQIVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIAEAVDTPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction likely involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.373 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLIQLVTHDRAGERVLEDLLIDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCEATTMLKVGTASLVLEMIEAGVPFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYSRAVEYLQSREPNTQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDLAYHDIKRGRGVFDLLQRKGLAARITTDEEIDAAVTTPPQTTRAKLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.389 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLIQLVTHDRAGERVLEDLLIDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCESTTMLKVGTASLVLEMIEAGVPFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYSRAVDYLQTREPNSQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDLAYHDIKRGRGVFDLLQRKGLAARITTDEEIDAAVDTPPQTTRAKLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.389 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLIQLVTHDRAGERVLEDLLIDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCESTTMLKVGTASLVLEMIEAGVPFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYSRAVDYLQTREPNSQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDLAYHDIKRGRGVFDLLQRKGLAARITTDEEIDAAVDTPPQTTRAKLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.389 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLIQLVTHDRAGERVLEDLLIDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCESTTMLKVGTASLVLEMIEAGVPFRDFSLDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYSRAVDYLQTREPNSQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDLAYHDIKRGRGVFDLLQRKGLAARITTDEEIDAAVDTPPQTTRAKLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

pafA

Pup--protein ligase

452 amino acids

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.

Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.

51.384 kDa

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM