About Products Protein Database Contact

Protein expression services for pafA | Pup--protein ligase

Description
Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine.
Family
Belongs to the Pup ligase/Pup deamidase family. Pup-conjugating enzyme subfamily.
Species
Mycobacterium avium (strain 104)
Length
452 amino acids
Sequence
MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMCETTTMLKVGTAALVLEMIEAGVPFRDFSLDNPIRAIREVSHDITGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQIEQIVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKIAQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIAEAVDTPPQTTRARLRGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM
Mass
51.3 kDa
Simulated SDS-PAGE
Western blot of pafA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make pafA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here