osgep

Probable tRNA N6-adenosine threonylcarbamoyltransferase

336 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Osgep likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

37.202 kDa

MVYIMGFEGSANKLGIGIVKDDGTILSNIRHTFITPPGEGFLPKDTAKHHRSFILSLVEKSLEESKLKPSDIDCLAYTKGPGMGPPLRSVAVTVRMLSQLWDRPIVAVNHCIAHIEMGRLITGAVDPTILYVSGGNTQVISYSLKKYRIFGETIDIAVGNCLDRFARVIQIPNDPSPGYNIEQLAKKGKNLIELPYITKGMDVSFSGILSSIEGMVKNKQNKTQHSVEDLCYSLQEHLFSMLVETAERALAHCGQNEVLAVGGVGCNQRLQEMIQQMISQRNGKSFAIDERYCIDNGAMIAWAGYLIFKNGTTTPLSQTTTTQRFRTDQVDVTWRD

osgep

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Osgep likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.988 kDa

MPTVIGFEGSANKLGIGIIRDGVVLSNPRHTYITPPGQGFMPRDTAKHHQEHAIDILRRALDEAQIRPQDIDCICYTKGPGMGAPLVAVAVVARTVAQLWKKPIIGVNHCIGHIEMGRLITGANNPTVLYVSGGNTQVIAYLQKRYRIFGETIDIAVGNCLDRFARVLKLSNDPSPGYNIEQMAKKGKKLIELPYTVKGMDVSFSGILSYIECMAHKLLSSEECTPEDLCFSLQETVFAMLVETTERAMAHCGSNEVLIVGGVGCNKRLQEMMDVMAKERGAKLYATDERFCIDNGAMIAQAGWEMFQTGSVTPLEQTTCTQRFRTDEVEVTWRD

Osgep

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.357 kDa

MPAVLGFEGSANKIGVGVVRDGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEALTEAGLTPKDIDCIAYTKGPGMGAPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMGRLITGAVNPTVLYVSGGNTQVISYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNVRLQEMMATMCQERGAQLFATDERFCIDNGAMIAQAGWEMFQAGHRTPLQDSGITQRYRTDEVEVTWRD

osgep

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Osgep likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.936 kDa

MTIVVGFEGSANKIGVGIIQDGKVLSNPRRTYITPPGQGFMPSDTARHHRSCILDVLQEALEESNIKPEDVDCVAYTKGPGMGAPLLSVAIVARTVAQLWKKPLLGVNHCIGHIEMGRLITGAENPTVLYVSGGNTQVIAYSERCYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEDMSHKMLSSGECTPEDLCFSLQETLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCEERGAKIFATDERFCIDNGAMIAQAGWEMFRAGQVTNLQDSWITQRYRTDEVEVTWRD

OSGEP

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.502 kDa

MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTEAGLTSEDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLLGVNHCIGHIEMGRLITGATNPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMETMCQERGARLFATDERFCIDNGAMIAQAGWEMFQAGHRTPLSESGITQRYRTDEVEVTWRD

osgep

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.728 kDa

MTIVIGFEGSANKIGIGIIKDGEVLSNPRRTYITPPGQGFLPGETAKHHRSVILTVLQEALDEAGLKAADIDCVAYTKGPGMGAPLVTVAIVARTVAQLWGKPLLGVNHCIGHIEMGRLITNAQNPTVLYVSGGNTQVIAYSERRYRIFGETIDIAVGNCLDRFARVIKISNDPSPGYNIEQMAKKGNKYIELPYTVKGMDVSFSGILSYIEDAAHKMLSTDQCTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGVMCKERGARIFATDESFCIDNGAMIAQAGWEMFRSGHVTELPDSWITQRYRTDEVEVTWRD

OSGEP

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.427 kDa

MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD

Osgep

Probable tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.301 kDa

MPAVLGFEGSANKIGVGVVRDGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEALAEAGLTSKDIDCIAFTKGPGMGAPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMGRLITGAVNPTVLYVSGGNTQVISYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQERGAQLFATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEVTWRD