About Products Protein Database Contact

Protein expression services for osgep | Probable tRNA N6-adenosine threonylcarbamoyltransferase

Description
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Osgep likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.
Family
Belongs to the KAE1 / TsaD family.
Species
Dictyostelium discoideum
Length
336 amino acids
Sequence
MVYIMGFEGSANKLGIGIVKDDGTILSNIRHTFITPPGEGFLPKDTAKHHRSFILSLVEKSLEESKLKPSDIDCLAYTKGPGMGPPLRSVAVTVRMLSQLWDRPIVAVNHCIAHIEMGRLITGAVDPTILYVSGGNTQVISYSLKKYRIFGETIDIAVGNCLDRFARVIQIPNDPSPGYNIEQLAKKGKNLIELPYITKGMDVSFSGILSSIEGMVKNKQNKTQHSVEDLCYSLQEHLFSMLVETAERALAHCGQNEVLAVGGVGCNQRLQEMIQQMISQRNGKSFAIDERYCIDNGAMIAWAGYLIFKNGTTTPLSQTTTTQRFRTDQVDVTWRD
Mass
37.2 kDa
Simulated SDS-PAGE
Western blot of osgep recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make osgep using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here