Protein
Protein transport protein sec13
Organism
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Function
Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Nup-20/sec13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution (By similarity).
Similarity
Belongs to the WD repeat SEC13 family.
Sequence
MTAGAQVIANSGHDDMIHDAVLDYYGRRLATCSSDRTIKIFEIEGESQRLVETLKGHDGAVWSVAWAHPKYGNILASAGYDGKVLIWREQAGSWQRIFDFALHKASVNIVSWSPHEAGCLLACASSDGNVSVLEFKDNSWEHNIFHAHGLGVNSVSWAPATTPGSIVSSNPGPGSTGNRRFVTGGSDNLLKIWTFDPATNGYKLEREPLAGHTDWVRDVAWSPTVLQKSYIASASQDKTVRIWTSDAANPGEWKCKVLNFDAAVWRVSWSLSGNVLAASSDNNKVTLWKENLKGEWENVKTIEE