Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Nup-20/sec13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution (By similarity).

Belongs to the WD repeat SEC13 family.

304 amino acids

MTAGAQVIANSGHDDMIHDAVLDYYGRRLATCSSDRTIKIFEIEGESQRLVETLKGHDGAVWSVAWAHPKYGNILASAGYDGKVLIWREQAGSWQRIFDFALHKASVNIVSWSPHEAGCLLACASSDGNVSVLEFKDNSWEHNIFHAHGLGVNSVSWAPATTPGSIVSSNPGPGSTGNRRFVTGGSDNLLKIWTFDPATNGYKLEREPLAGHTDWVRDVAWSPTVLQKSYIASASQDKTVRIWTSDAANPGEWKCKVLNFDAAVWRVSWSLSGNVLAASSDNNKVTLWKENLKGEWENVKTIEE

33.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nup-20 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here