nuoA2

NADH-quinone oxidoreductase subunit A 2

152 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

17.347 kDa

MDYTISEFGKVFLFLLFGVVFVIGGYVSSRMLRPHRPNDEKLTSYECGEEAVGSAWVQFNIRFYVVALIFIIFDVEVLFLFPWATVFKQLGGFALFEAVIFVTILTLGLVYAWVKGDLDWVRPTPNVPKMPEKRFDNISSGRSQVVKEESVS

nuoA2

NADH-quinone oxidoreductase subunit A 2

142 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.776 kDa

MQPAGISHSLFPSLPPEFLPLALYTLAASILIGVLLLAAWWLGAKTTNRNKELPYESGAIPTGSARLAYPVPFYLIAIFFIVFDVEAAFIFAWATAWRELGLQGLVHITFFIVILLLGLVWLWLKGGLDWGPSRARRGHVRD

nuoA2

NADH-quinone oxidoreductase subunit A 2

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.01 kDa

MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSSLLGSKAFGRSKNEPFESGIVPTGGARLRLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGALDWAPESRRKRQAKLKQ

nuoA2

NADH-quinone oxidoreductase subunit A 2

132 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.592 kDa

MHGILSPGAWAFIAYVLGAVALCLVMLGLGRVLGGRSHGRAKNLPFESGVDSTGSARLRFPVKYALVAMLFVIFGIEMPFLYLWAVSVRENGWAGFVEVALFVSLLLAGLFYLHRVGALDWSPERRRRKPRD

nuoA2

NADH-quinone oxidoreductase subunit A 2

132 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.713 kDa

MYASFAPATWALLAYLFGALALCLLMLGLGRVLGGRSHGRAKNLPFESGVDSTGSSRLRFSVKYALVAMLFVIFGIEMPFLYLWAVSLRENGWAGFVEATLFVSLLLVGLFYLHRVGALDWSPERRRKKPHD

nuoA2

NADH-quinone oxidoreductase subunit A 2

121 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.481 kDa

MTAMEFLPVLFMVTGIVLVAAATLFVSSLLRPSNPYPEKNAPYECGMEAAGEAAGGRFRVPFFILAILLVVFDVEAMFLFPWAVVLKEIGFVGYIEMFVFMLLLLVGFAYAWLKGALEWQE

nuoA2

NADH-quinone oxidoreductase subunit A 2

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.28 kDa

MLGAYLPILVLVVIAVLFGLGSVIFSSLIGQKKPSTVKLAPYECGCEPVGSARERFSIKFYLIAMLFILFDIEAVFLYPWAVLFKRLGMFGLIEMGVFIVILFVGYVYVWKKGALEWE

nuoA2

NADH-quinone oxidoreductase subunit A 2

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.316 kDa

MLGAYLPILVLVAIAVIFGLCSLVFSSLIGQKKPSVVKLAPYECGCEPVGSARERFSVKFYIIAMLFILFDIEAVFLYPWSVLFKRLGMFGVMEMGVFIVILFVGYIYVWKKGALEWE

nuoA2

NADH-quinone oxidoreductase subunit A 2

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.318 kDa

MLGAYLPIIVLVVVAVLFGCGSLIFSSLIGQKKPSVVKMAPYECGCEPVGSARERFSIKFYIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE