About Products Protein Database Contact

Protein expression services for nuoA2 | NADH-quinone oxidoreductase subunit A 2

Description
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Family
Belongs to the complex I subunit 3 family.
Species
Pseudomonas aeruginosa (strain PA7)
Length
132 amino acids
Sequence
MHGILSPGAWAFIAYVLGAVALCLVMLGLGRVLGGRSHGRAKNLPFESGVDSTGSARLRFPVKYALVAMLFVIFGIEMPFLYLWAVSVRENGWAGFVEVALFVSLLLAGLFYLHRVGALDWSPERRRRKPRD
Mass
14.6 kDa
Simulated SDS-PAGE
Western blot of nuoA2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make nuoA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here