nero

Deoxyhypusine hydroxylase

302 amino acids

Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor (By similarity). Essential for organismal viability and plays a role in a wide number of important processes such as cell growth and proliferation, and regulates induction of autophagy and protein synthesis. Has a role in eIF-5A-mediated translational control.

Belongs to the deoxyhypusine hydroxylase family.

33.564 kDa

MVSQQQIEAIGGVLNNKERPLKERFRALFTLKNIGGGAAIEAISKAFDDDSALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAETCAIALDRVRWLQSGQKVDDSNPYASVDPSPPTAGDKSVTELKAIYLDAQQSLFDRYRAMFSLRNLRTEESVLAIAEGLKDSSALFRHEVAFVLGQLQEPCSIPFLQENLEDRLENEMVRHECAEALGAIATEDCIQILNRYAEDDKRVVKESCVIALDMCEYENSPEFQYADGLAKLDATK

nero

Deoxyhypusine hydroxylase

302 amino acids

Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor. Essential for organismal viability and plays a role in a wide number of important processes such as cell growth and proliferation, and regulates induction of autophagy and protein synthesis. Has a role in eIF-5A-mediated translational control.

Belongs to the deoxyhypusine hydroxylase family.

33.5 kDa

MVSQEQIEAIGGVLNNKDRPLKERFRALFTLKNIGGKTAIDAISKAFDDDSALLKHELAYCLGQMQDPTALEILTKVLKDTTQEPMVRHEAAEAMGAIGHADVLAILEEYKKDPVVEVAETCAIALDRVRWLQSGQQVADNNPYASVDPSPPTAGDKSVAELKAIYLDAKQTLFDRYRAMFSLRNLCTEESVLAIAEGLKDSSALFRHEVAFVLGQLQEPCSIPYLQENLEDHKENEMVRHECAEALGAIATDDCIQILTRYADDEKRVVKESCVIALDMCEYENSPEFQYADGLSKLDGTK