About Products Protein Database Contact

Protein expression services for nero | Deoxyhypusine hydroxylase

Description
Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor. Essential for organismal viability and plays a role in a wide number of important processes such as cell growth and proliferation, and regulates induction of autophagy and protein synthesis. Has a role in eIF-5A-mediated translational control.
Family
Belongs to the deoxyhypusine hydroxylase family.
Species
Drosophila pseudoobscura pseudoobscura
Length
302 amino acids
Sequence
MVSQEQIEAIGGVLNNKDRPLKERFRALFTLKNIGGKTAIDAISKAFDDDSALLKHELAYCLGQMQDPTALEILTKVLKDTTQEPMVRHEAAEAMGAIGHADVLAILEEYKKDPVVEVAETCAIALDRVRWLQSGQQVADNNPYASVDPSPPTAGDKSVAELKAIYLDAKQTLFDRYRAMFSLRNLCTEESVLAIAEGLKDSSALFRHEVAFVLGQLQEPCSIPYLQENLEDHKENEMVRHECAEALGAIATDDCIQILTRYADDEKRVVKESCVIALDMCEYENSPEFQYADGLSKLDGTK
Mass
33.5 kDa
Simulated SDS-PAGE
Western blot of nero recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make nero using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here