mrm1

rRNA methyltransferase 1, mitochondrial

531 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of a 2'-O-methylguanosine in the mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.

60.066 kDa

MISIFKILSSPKPATTTTNIINPINIINGIRYFSSNQEDYPLFKKPVFNGKVLRGGRKVFKNDLIYSKKESHYNNNNNSNNNSNNNNNNNNSNNRNNNNFSNNRNNNNNRNNNNNNSNRNNNNSNDNNFRNNNNNNRRTEYYKNDFDSSKYISNKPEIRIFDLHEQAVYGINPVWVALSSGNRTFNALYVCGTLLPKLKELGIDIKNIENSKREYISDFDHNYGRETNQIEDENQDEQYSNQHDEQEQNEYEEEQEEEKVQEEEEDNNNNNNIKKTTFNRYNDRKNLVALKEIVKNSFKLKIPVRSVNKGTLDSFSKGRPHQGIILDASPLTLLNIDFLEKFDINERVNKRMNGGGGGGGGGGGNKINNDKYPLWLVLDELWDPQNVGAIIRNCSFFNIDGVVISNKNSSPITPAASKSSSGACESFVINRTESIEGFLKSSQRNGWNVVGTSLDDLNENQPCLDINQIKLDQPTILILGNEGFGLKPSVLEICNKTIKIVGGNYKIDSLNVSVTSGILIHTLLSSGTLPK

MRM1

rRNA methyltransferase 1, mitochondrial

412 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methylguanosine at position 2270 (Gm2270) in the 21S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA. This modification seems to be important for the normal accumulation of the mitochondrial large ribosomal subunit.

Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.

46.387 kDa

MTSLTNAVFKRYLAVTPSAHQALKTRIKKKSSSFDKFFPQQSNSRKKQWETLNEDKASWFKRKYAHVHAREQDRAADPYGKKKAHVEKLKEIKNQAKLNQKSHKSKFQNKDIALKLMNDNPIFEYVYGTNSVYAALLNPSRNCHSRLLYHGTIPSKFLQIVDELKVTTELVDKHRLNLLTNYGVHNNIALETKPLQPVEIAYLGDMDTSSAALSIHELGFNNENIPHELPYGTKTDAKKFPLGLYLDEITDPHNIGAIIRSAYFLGVDFIVMSRRNCSPLTPVVSKTSSGALELLPIFYVDKPLEFFTKSQEMGGWTFITSHLANATSEKYTVGKTISMHDLNGLCNELPVVLVVGNESQGVRTNLKMRSDFFVEIPFGGIEKGNRAPEPIVDSLNVSVATALLIDNILTCK

MRM1

rRNA methyltransferase 1, mitochondrial

353 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methylguanosine at position 1145 (Gm1145) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.

38.638 kDa

MALLSTVRGATWGRLVTRHFSHAARHGERPGGEELSRLLLDDLVPTSRLELLFGMTPCLLALQAARRSVARLLLQAGKAGLQGKRAELLRMAEARDIPVLRPRRQKLDTMCRYQVHQGVCMEVSPLRPRPWREAGEASPGDDPQQLWLVLDGIQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPVVSKSSAGAMEVMDVFSTDDLTGFLQTKAQQGWLVAGTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQLLLTILPRRQLPPGLESLNVSVAAGILLHSICSQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSSGPEKERQNEG

Mrm1

rRNA methyltransferase 1, mitochondrial

320 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methylguanosine at position 1145 (Gm1145) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.

34.843 kDa

MRRLWTVGCFSRLIARHFSSVARRGERPGGEELSRLLLDDLAPAQRLERLFGLSPCLLALRAARRRVARLLLQAGKAGLQGERAELLRVAEARGIPVLRPRRQKLDALCGYQVHQGVCMEVSPLRPRPCDEAADTSSGDDPQQLWLVLEGLQDPRNLGAVMRSAHFLGVDRVITSQRNSCPLTPVVSKASAGAMEVMDVFATPDLPGFLQAKAQQGWLVVGTVGCPGPEISQSSKVPITSCLEFVWDRPTLLVLGSEGSGLSQEVFASCQLLLTILPRRHLPPGLESLNVSVATGILLHSICSQKKGFPVQERGQLLQDS

mrm1

rRNA methyltransferase 1, mitochondrial

301 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of the 2'-O-methylguanosine corresponding to position 2270 in S.cerevisiae 21S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.

33.402 kDa

MIRSRVNLAREVPKKAKAHLSKERRLIKEDSEFVFGTHSVKNALATRKRECRALYVQNADIHSEFEEFLNKLQYKIPIKSVNKEHLNQITACRPHNGVVLEASSLNVPTISDLLFPAGEEYNNKNGQDSPHNDLNEGKSSSSDNYPPLYVYVDGITDPQNMGAVIRSAYILGAKGILLSKKHNTFLSPVVSKASAGALEVFNISHVKNPMVFLRNSVLKGWKVIGTKPALPDNKDQIYTPHKIKTELMNEPKILVLGSEKGLRTNILTQCSHYVSIPGGDKYVDSLNVSVAAGILLYSLVN

MRM1

rRNA methyltransferase 1, mitochondrial

138 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of the 2'-O-methylguanosine corresponding to position 2270 in S.cerevisiae 21S mitochondrial large ribosomal RNA, a universally conserved modification in the peptidyl transferase domain of the 21S rRNA.

Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.

16.188 kDa

single

MNNQPCSIVWRRFLTSKVKPAVRIPNENLKANKPTNFTKNFPLNERTKAWERAGEDKESWFKRKYAHVHAKQKSQPQVDLYGKKEAHYSRLKQDILSSKRQQEEHKSKYSRKSVTLGLRPNPLMEYIYGTNSVIAALN