minC

Probable septum site-determining protein MinC

366 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

In the C-terminal section; belongs to the MinC family.

39.704 kDa

MTSDSAIPNLGSNSAFSDAESNSTVVNPKSNSTSPDAESNSVIPDAELNSVLQYLKLNAEVTNVESDAPMVDEQVNSAPAHINLPDLDLDLEPISPATDVNSNSGWLSLNSPESVVDNKVKNNIQVQLKTEAGRLLVVLPTELQVPATEFTWSDIWQQLKFRLNAGDRLRTRNTTVHLVAYDRLLDGRQLQQLAETFSEVQLQLKSVATSRRQTAIAAVTSGYSVEQLQPETILSSEPKATSTPQADALYLEMTIRSGVEIRHPGTVILLGDINPGGIVVADGDILVWGRLRGIAHAGAGGNRDCLIMSLQMEPTQLRIADAVARAPEKSPTHFFPEVAHITSQGIRIVRSTDFSRNQISKINQTP

minC

Probable septum site-determining protein MinC

292 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

30.788 kDa

MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTPVARAPQVIDTAPPNDVATPVPSVPEATAEAAAKAGPQDDEAYGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG

minC

Probable septum site-determining protein MinC

292 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

30.798 kDa

MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEDANLQGARDAGLVPVELSTPVARAPQVIDTAPPNDVATPVPSVPEATAEAAAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG

minC

Probable septum site-determining protein MinC

292 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

30.76 kDa

MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG

minC

Probable septum site-determining protein MinC

290 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

31.678 kDa

MGKADIVIKGSKDGLTFFLDSQCDFSELAAAIETKLASADFFLVGAHVTVDVGTRQLHPDQIERLQTLFPSYGLILRGINSWADPVGQHDEEERVVLKGNRERIYQIANHLYESTERADGAARNYDYRDESASSFSPVGTAPDYAEATTEPADCFGGSPSDMQTAILTQGGDERTLLIQRTLRSGQTVRYPGHVVILGDVNPGAEVVAGGNIIVMGVFRGVAHAGAMGSDEAVVTAYRLRPTQLRIANHITRPPDEEEEGPEHPEIARIRDGMVTIERYHYGTKSYGKDV

minC

Probable septum site-determining protein MinC

284 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

30.372 kDa

MSPKKSPFFELRSGSVDTLLFVVKTTDLDAMRAELTRRFEATPEFFANDVVAIDVRRLAENERVPLADIAQLLDSVRMRPVGVVANPQQAWAAESQLPLLEARDRRGATNAAKSADEDIANAAAAAPAVTAATATPPSDLFELAAGTPENGTPATAAAVEPAPAAEPVRLATSSQTMVVDKPLRSGQRIYAKGDLVVLGLVSYGAEVIAEGNIHIYAPLRGRALAGVQGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKPVQIWLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

282 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

30.171 kDa

MSPRKSPFFELRSGAVDTLLFVVKTTDLAEMRAELTRRFEATPEFFANDTVAIDVRRLAENERVPLAEIATLLGSVRMRPIGVVADSTQHGWANEAGLPLLDARDPRGGRNHGDEAGEEAPGKPGAVAPKPDAAPPADAASNAQVQMQLPIAAQEDGAPQAAAEGVRIGTSSQTTVIDKPLRSGQRIYAKGDLVVLGMVSNGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEAELISIAGIYRTTENPLPADVHGKPVQIWLDEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

282 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

29.937 kDa

MSPKKSPFFELRSGSVDTLLFVVKTTDLEAMRAELTRRFEATPEFFANDVVAIDVRRLAGNERVALADIAQLLDSVRMRPVGVVADAQQAWAAESALPLLEARDRRGAAARSADEESANAAAAAPAATAATATPPADLFESVAGTPESGTPATAAAVEPAPAAEPVRLATSSQTMVVDKPLRSGQRIYAKGDLVVLGLVSYGAEVIAEGNIHIYAPLRGRALAGVQGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKPVQIWLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

282 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

29.772 kDa

MSQKKSPRFELRSGNVDALLLALNTADLDAVRDDLLSRFESTPDFFSDDVVALDLRRLEGTGALALDRVIDTLATLKARAIGVVARADQRDWAGGFGLPLLDSQSRRGGKDEAPKEKAGKPEATAASGQTDAEAAGNTGKGKDSEGAAVNGKASEIAEIMAAANAASAPRAIPTLLIDKPLRSGQQIYAQGDVVILDLVSYGAEVIAEGNIHIYAPLRGRALAGVKGNPDARIFCTCLEPELISIAGIYRTAEQTLPADVLGKSAQVRLADEKLILEPLRMK

minC

Probable septum site-determining protein MinC

278 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

29.374 kDa

MTTEPLALDFKSATLYAIRVVLHSADPDQLAEALGRRMADAGSFFENEAVVIDASRVSAPIDWPALVKALGAHKLPVIGVVAENGNLERARAAGLIPVELSAPRTQQSVDPAPPNHVSTPVPAAPEASRAAQEQLRSAMKGDAQAVPTRAARDTTEAASHTPAAPQSSTALVITKPLRSGQRVYARHTDLVVIGMVSQGAEVIADGNIHVYGPLRGKAMAGARGDTSARIFTTHLDAELLAVAGVYRVVEDRLDRNLHNQPALVRLNGDTLHIEALKS

minC

Probable septum site-determining protein MinC

278 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

30.16 kDa

MYISNQIDPEWPRSTGCGPVGAISRATLICNLCALARSRPAMQTLPNSLPTQVTFKGTLEGLRLLIPVALPWEEVVLQLQHRLNAGERLWQGGAVVILEVGERLLDGPQLQAVTEMLTAQQLHLMRVRTVRRQTAVAAAVAGLSVEQQEAPPEENPDKPPALRGLAEPLYLQTTLRSGMSLVHPGTVIVVGDVNPGAEIVADGDILVWGTLRGVAHAGAHGNTRALIFALRLRPIQLRIADRVARASDEPPAAPQPEVAYIQDNTIHIAITTEFARRW

minC

Probable septum site-determining protein MinC

277 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.392 kDa

MTTDSLALDFKSATLYAIRVVLHDADLDRLTAALDQRMADAGSFFENEPVVVDASRVDDPIDWPALLAALRGHNLPPIGVVAEGANLAAAQAAGLAAVELSTPPARPAPAVETAPPNDAATPVPAVPAAALETGASATTGNAPAEPAPAEPAAPAAAPQPPAVPAPASALVITKPLRSGQRVYARHTDLVVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDSTLHNQPALVYLDGETLRVEALKR

minC

Probable septum site-determining protein MinC

277 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.722 kDa

MTFAAPLEAKSIRFRARSFVAFTLTPEAPMVEWLQGLDHWIGNSPGYFAGRPVLLDLNVLKPAPSEIAALVAELGTRGIRIYAIELEGASLGPDLPPLLVGAKEATTEGLLPGRKGGQEGSGKPDGKAAEGRAPDHGTEGRADAGAAGKGKAGASKTDESGPQVSHYDSGTLMIKTPIRSGQAIMHAHGDVIVLGSVASGSEIVAAGSIHVYGTLRGRASAGALGNTAARIFCRRNEAELLSVDGWYITAEEMEGVSRGKPVQAFLDGDGLRVETLS

minC

Probable septum site-determining protein MinC

271 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.886 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADNERVPLDDIRGMLSDVRMRAIGVVAQPEQHAWAAGAGLPLLEARDRRAPSPKAADDAPAQPEEPRVPAAGQAALFAQAGPSGADAVAPPAVAAAPVVAAQSATLVIDKPLRSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.822 kDa

MSQKKSPRFELRSGNVDALLLALQTADMAALRDDLLARFEATPDFFSNDVIALDLRALEDDSEVALGTVIETLATLRARAIGVVARPGQREWAERFGLPLLDSQARRGSGADRATDRAAEARAAAAAEQAAADQAAREESIRAAAQATTDAAVAAAIRQTQTMLIDKPLRSGQQVYAQGDVVILDVVSYGAEVIAEGNIHIYAPLRGRALAGVKGNTGARIFSTCMEPELISIAGIYRTAEQTLPADVLGKTAQVRLADEKLILEALRLK

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.94 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRVIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLHSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.94 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRVIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLHSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.94 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRVIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLHSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.94 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRVIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLHSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.931 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRAIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLRSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.931 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRAIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLRSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.873 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLAGHERVPLDDIRGMLNDVRMRAIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLRSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

270 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.931 kDa

MSLKKSPFFELRSGSVDTLLFIVKTADLDALRAELVKRFEATPEFFADDVVAIDVRRLADHERVPLDDIRGMLNDVRMRAIGVVAQPEQHAWAASAGLPLLEARDRRAPSSKAADEAPVQQAEPAAPAAGQAALFEQAGPTLADAGAPPESPAPAVAAQSATLVVDRPLRSGQQIYAKGDLVVLGPVSYGAEVIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEQEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

266 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.442 kDa

MTEVLTEPRSIRIKGRSFLAVVLSPDLPVDNWLERLDDLASRSAGFFLGRPVVLDVAELAISRDELKALIAELSSRNVSIMGLEGARPSMVERGMPPILKGGRPVSDVDVPKVEPESPPAEEKKKTGKATKASGKSDEIGETDSPQAMITAPQARSVVQSLLLREPVRSGQSVIFTEGDVTVIGSVASGAEIIAGGSIHIYGALRGRAMAGSVGNASARIFCRKMEAELLAIDGIYKMAEDMPPELLGKPVQLWLEDDVIKAEKMA

minC

Probable septum site-determining protein MinC

266 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.694 kDa

MSEAESTPVEEPVVESTEGSEAIPEVEQSTPLVSGLTLEHCGGRYRLTLPSDLDWIDLWPQLQLYLVGQEHLWSETLPVDCACGQRLLDQSQLQQLAEALSEHQLRLDRIITGRRQTAIAAATLGYSVQQEELPPLLVKEADGPSQATANPLYLKTTLRSGIEIHHDASVIIVGDVNAGASIIAAGDIIVWGRLRGVAHAGAKGNLGARIMTLEMAATQLRIADLLARTPDPPRPPYPEVAYATDQGIQIAPAYTWGRVFAVSAAP

minC

Probable septum site-determining protein MinC

264 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.386 kDa

MSQKKAPLFEIRSGTVDALLLSPRTADMDALAAELTRRFADTPEFFSNDVIAIDVRRLAEDERLPIDRLVETLTALRARAIGVVASPEQAGWAQAFGLPLLDSHGRRPRGGNDAKDADRNDAQDAQGAPEHAQAAEAPASTSAIPPADAAAMQPGTMIVDRPLRSGQRIYARGDLVVLDLVSDGAEVIAEGNIYVYASLRGRALAGVKGNLDARIFCTCLEPQLISIAGIYRTGETPWPDAYASKPAQVRLADNTLVFEPLRMK

minC

Probable septum site-determining protein MinC

263 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.22 kDa

MSQADLLDQDPVFQLKGSMLAVTILELAHNDLARLERQLADKVAQAPNFFRDTPLVMALDKLPEGEGRLDLPALLEVCRRHGLRTLAIRAGREEDIAAAQALDLPVLPPSGARERPLDIKDSAPRKPAEEVRPSAGEPRPEPAKPEEKPAEPASRPTKVVKTPVRGGMQIYAAGGDLIVLAAVSPGAELLADGNIHVYGPMRGRALAGVKGDATARIFCQQLAAELVSIAGNYKVAEDLRRSPQWGKAVHVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

263 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.124 kDa

MSQADLLDQDPVFQLKGSMLAVTILELAHNDLARLERQLADKVAQAPNFFRDTPLVMALDKLPEGEGRLDLPALLEVCRRHGLRTLAIRAGREEDIAAAQALDLPVLPPSGARERPLDIKDSAPRKPAEEPSPSAGEARPEPAKAEEKPAEPVSRPTKVVKTPVRGGMQIYAAGGDLIVLAAVSPGAELLADGNIHVYGPMRGRALAGVKGDATARIFCQQLAAELVSIAGNYKVAEDLRRSPQWGKAVHVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

263 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.11 kDa

MSQADLLDQDPVFQLKGSMLAVTILELAHNDLARLERQLADKVAQAPNFFRDTPLVMALDKLPEGEGRLDLPALLEVCRRHGLRTLAIRAGREEDIAAAQALDLPVLPPSGARERPLDIKDSAPRKPAEEPSPSAGEARPEPAKAEEKPADPVSRPTKVVKTPVRGGMQIYAAGGDLIVLAAVSPGAELLADGNIHVYGPMRGRALAGVKGDATARIFCQQLAAELVSIAGNYKVAEDLRRSPQWGKAVHVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

263 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.124 kDa

MSQADLLDQDPVFQLKGSMLAVTILELAHNDLARLERQLADKVAQAPNFFRDTPLVMALDKLPEGEGRLDLPALLEVCRRHGLRTLAIRAGREEDIAAAQALDLPVLPPSGARERPLDIKDSAPRKPAEEPSPSAGEARPEPAKAEEKPAEPVSRPTKVVKTPVRGGMQIYAAGGDLIVLAAVSPGAELLADGNIHVYGPMRGRALAGVKGDATARIFCQQLAAELVSIAGNYKVAEDLRRSPQWGKAVHVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

261 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.944 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRAELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRAPAAKPADEAEPAAVPAVETAAAPAAAAAPEQPSEPAPTLVQAGGQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

261 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.92 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRAELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRAPAAKPADEAEPAAVPAVETAAAPAAAAAPEQSSDPAPTLVQAGGQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

261 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.944 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRAELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRAPAAKPADEAEPAAVPAVETAAAPAAAAAPEQPSEPAPTLVQAGGQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

261 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.978 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRTELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRAPAAKPADEAEPAAVLAVEAAAAPAAAAAPEQSSDPVPTLLQAGGQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

257 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.769 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRTELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRTPAAKHADEAEPAPAPVVEAAAAPAAESAQEPAPTLLHAGGRTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPAEVLGKSVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

257 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.522 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRAELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLSDVRMRPVGVVALATQGWATEAGLPLLEARDRRAPAAKAADEAEPVAAPAVEAAAAPAAEPTPEPGAASQPAGVQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADVLGKSVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

256 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.626 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRTELVKRFEATPEFFADDVVAIDVRRLADGERVELADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRVSAAKPDEAEPAPVVADAVAAATTAEPAPEPAPTQISAGGQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADILGKAVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

256 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.592 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRAELVKRFEATPEFFADDVVAIDVRRLAEGERVALSDIRQMLNDVRMRPVGVVAQASQAWAAEAGLPLLEARDRRGATAKPEPADEAEPPVAAAAAEAVPEPAPELAPSAPTTGAQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADILGKAVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

255 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.4 kDa

MSQKKAPLFEIRSGTVDALLLSPRTADMDALAAELTRRFADTPEFFSNDVIAIDVRRLAADERLPIDRLVETLTGLRARAIGVVASPEQAEWAQACGLPLLDSHGRRPRGERSEEAAEAVPAAAEPVPAPAASPAPPVEAVAMQPGAMIIEKPLRSGQRVYARGDLVVLDLVSDGAEVIAEGNIYVYASLRGRALAGVKGNLDARIFCTCLEPQLISIAGIYRTGETPWPEAFASKPAQIRLSENTLVLEPLRMK

minC

Probable septum site-determining protein MinC

254 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.41 kDa

MSLKKSPFFELRSGSVDTLLFTVKTTDLDALRTELVKRFEATPEFFADDVVAIDVRRLADGERVALADIRQMLNDVRMRPVGVVALATQGWAGEAGLPLLEARDRRVSAAKPADEAEPAPVVAEAVAAAEPAPEPAPTQISASGQTLVIDRPLRSGQQIYAKGDLVVLAPVSHGAEIIAEGNIHIYAPLRGRALAGVHGNHDARIFCTCLEPELISIAGIYRTTENPLPADILGKAVQIRLEEEKLMIEPLRLT

minC

Probable septum site-determining protein MinC

251 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.2 kDa

MSERGYELKGSVFTMTVLHLEDAIPEQIQQLLEQKASQAPKFFDSAPLVINVEMLTEIPDFSKIMSAILTANFIPVGVTGVKSNEMREAAKQARLAILTAGKETNTDAVVLHTPKESIYKTPSELREEQQTSPGTTADPDNLVPTKVVQGNVRSGQQIYSPGPVVILGSVSNGAEIISNDSIHVYGTLRGRALAGARGNHDARIFCGHLEAELISIAGHYLLSDSLPEPHVGQEVQISLENEKIIFDKLTS

minC

Probable septum site-determining protein MinC

250 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.739 kDa

MSPNQTPDNTPVFQLKGSMLAITVLELARNDLESLDRQLAAKVAQAPNFFSNTPLVLALDKLPADEGAIDLPGLMRICRHHGLRTLAIRASRIEDIAAAIAIDLPVLPPSGARERPLEPEPEAKKPEPEPTPPPAPAEPEVRPTRIITSPVRGGQQIYAQGGDLVVTGSVSPGAELLADGNIHVYGAMRGRALAGIKGNTKARIFCQQMTAEMVSIAGQYKVCEDLRRDPLWGSGVQVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

250 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.758 kDa

MSPNHTPDTASVFQLKGSMLAITVLELARNDLEALDRQLAAKVAQAPNFFSNTPLVLALDKLPADEGAIDLPGLMRICRHHGLRTLAIRANRIEDIAAAIAIDLPVLPPSGARERPLEPEPEVVKKPEPAPAPPPPPEPEVRPTRIITSPVRGGQQIYAQGGDLVVTASVSPGAELLADGNIHVYGAMRGRALAGIKGNTKARIFCQQMTAEMVSIAGQYKVCEDLRRDPLWGTSVQVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

249 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.599 kDa

MTKVLTDARSIRIKGRSFLALVLSPELPLDWWLGRLDDLASRSAGFFLGRPVVLDVADLEIDRKQLKSLLDELGQRNVRVMGIEGGRPSLFEPGMPPAMKGGRPAPDFEVPEVDPADPPKAGKGKAAAPITPEEVQPVRATASIIVREPVRSGQSVIFPEGDVTVVGSVASGAEIVAGGSVHIYGTLRGRALAGSVGNASARIFCRRLEAELLAIDGVYKTAEDMAPNLRGQSVQLWLEGDSIMAERLN

minC

Probable septum site-determining protein MinC

249 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.825 kDa

MSDSAATDTKQSFQLKSASVSLTALELYYFDNDEFEANLRDKISQAPGFFKDIPLIISLEKYEGLDSELDFFRMIGTCRRHNIHVIGVRAANDDQRRLARGASLALLPGGSLKEKPAQEAPAQAEPEAAAAPEPANEPAPAKIINQPVRSGQQVYAPEGDLIILAPVQAGAEVLAAGNIHVYGPLRGRALAGIHGAESARVFCQSLEAELVSIAGHYKISEDLQDIGWKSAVQIQLRDDVLVVTPLDKA

minC

Probable septum site-determining protein MinC

249 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.521 kDa

MASVNVDFEQAGELKIGQVGIANLRVRTLDVSRLVQEMRERVTRAPKLFGRAAVILDFGGLSQVPDLATAKALLEGLRDAGVLPVALAYGTSEIDLLSQQLGVPLLAKFRAQYEPTAVSPPPPPPPPPARAEPAPPAARPAPGRMQRTAVRSGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAELVAIAGHYKVLDDVPMDLRGKAVQVWLEQDQIKIAALD

minC

Probable septum site-determining protein MinC

249 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.676 kDa

MSSVNVDFEQAGELKIGQVGIANLRIRTLDVPRLVREMQDRVTRAPKLFGRAAVILDFGGLAQAPDLATAKALLDGLRSAGVLPVALAYGTSEIDLLSQQLGIPLLAKFRAQYETAAVRPPQPPPPPHARAEPAAPVARPAPVRMQRNTVRSGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAELVAIAGHYKVLDDVPMDLRGKAVQVWLEQDQIKIAALD

minC

Probable septum site-determining protein MinC

249 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.494 kDa

MSSVNVDFEQAGELKIGQVGIANLRIRTLDVPRLVREMQDRVTRAPKLFGRAAVILDFGGLAQTPDLATAKALLDGLRSAGVLPVALAYGTSEIDLLSQQLGIPLLAKFRAQYETAAVSPPPPPPPPPARAEPAAPVARPAPGRMQRNAVRSGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAELVAIAGHYKVLDDVPMDLRGKAVQVWLEQDQIKIAALD

minC

Probable septum site-determining protein MinC

249 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.463 kDa

MSSVNVDFEQAGELKIGQVGIANLRIRTLDVPRLVREMQDRVTRAPKLFGRAAVILDFGGLAQAPDLATAKALLDGLRSAGVLPVALAYGTSEIDLLSQQLGIPLLAKFRAQYETAAVSPPPPPPPPPARAEPAAPVARPAPGRMQRNAVRSGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAELVAIAGHYKVLDDVPMDLRGKAVQVWLEQDQIKIAALD

minC

Probable septum site-determining protein MinC

248 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.589 kDa

MNQVLTETRPIRLKGRSFLAMVLSPELPLDGWLERLDDLARRSSGFFLGRPVVLDMENLAIERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPPAMRGGQPAADFEAPAGEPQANPGAPEPQISQAVRAPGHAVHAMPSMVITEPVRSGQSVYFPEGDVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAELVAIDGLYKTAEDLEPRFRGQAVQLWLDGDYMMIDTLS

minC

Probable septum site-determining protein MinC

248 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.589 kDa

MNQVLTETRPIRLKGRSFLAMVLSPELPLDGWLERLDDLARRSSGFFLGRPVVLDMENLAIERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPPAMRGGQPAADFEAPAGEPQANPGAPEPQISQAVRAPGHAVHAMPSMVITEPVRSGQSVYFPEGDVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAELVAIDGLYKTAEDLEPRFRGQAVQLWLDGDYMMIDTLS

minC

Probable septum site-determining protein MinC

248 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.545 kDa

MNQVLTETRPIRLKGRSFLAMVLSPELPLDGWLELLDDLARRSSGFFLGRPVVLDMENLAIERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPPAMRGGQPAADFEAPAGEPQANPGAPEPQISQAVRAPGHAVHAMPSMVITEPVRSGQSVYFPEGDVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAELVAIDGLYKTAEDLEPRFRGQAVQLWLDGDYMMIDTLS

minC

Probable septum site-determining protein MinC

248 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.405 kDa

MASVNVDFEQAGELKIGQVGIANLRVRTLDVPRLVQEMRERVSRAPKLFGRAAVILDFGGLSQVPDLATAKALLDGLRDAGVLPVALAYGTSEIDLLSQQLGVPLLAKFRAQYEPTAVSPPPPPPPPARAEPAPPAARPAPGRMQRTAVRSGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAELVAIAGHYKVLDDVPMDLRGKAVQVWLEQDQIKIAALD

minC

Probable septum site-determining protein MinC

247 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

26.842 kDa

MSDDTPHPEWQLVPQGNFVRLSLTLPTVTTAPDSPSLVFSHQQLEQSLGNYLRIMAGRWQDQTLVRLAVNNQLLDARQLQAIAAGLKEQNLTLQWVETNRRQTAVAAASAGLSVDQTMADKPLVDPSETPSLPKPLVVRHTLRSGGEIRHGGDVVIIGDVNPGSSIVADGDILIWGCLRGMAHAGAKGNDQAVIMILRLAACQIRIGDRLARVGADAVDRREPEIAYITSEGIRLTPVRQFQRSALL

minC

Probable septum site-determining protein MinC

246 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.968 kDa

MNVLDNSVIIKGSKNGITVFLDEEMPFEELLENVSDKFKNASKFFNNATMAISFDGRNLSAEEEKRILNVISDVSELNIVCVLDENNDIKSVYEEAVKKAMNSFNISHQPERQKITDPKTTCMFYKGTLRSGQVFEADGSVVVLGDVNPGGKVVAKGSVIVLGSLKGNIFAGVDGNENAFVVALEMSPMQIKIGDIIARSSDSGVNKISKGKNKSKILEPKIAYVYDQNIYVEDLEQNALDDISLD

minC

Probable septum site-determining protein MinC

246 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.968 kDa

MNVLDNSVIIKGSKNGITVFLDEEMPFEELLENVSDKFKNASKFFNNATMAISFDGRNLSAEEEKRILNVISDVSELNIVCVLDENNDIKSVYEEAVKKAMNSFNISHQPERQKITDPKTTCMFYKGTLRSGQVFEADGSVVVLGDVNPGGKVVAKGSVIVLGSLKGNIFAGVDGNENAFVVALEMSPMQIKIGDIIARSSDSGVNKISKGKNKSKILEPKIAYVYDQNIYVEDLEQNALDDISLD

minC

Probable septum site-determining protein MinC

246 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.452 kDa

MSQIESQNPEPVFQLKGSMLAITVMELARTNLEALDRQLAAKVAQAPNFFSNTPLILALDKLAPNEGPVDLPGLVRICRQHGLRTLAIRANRIEDIAAAIAVDLPVLPPSGARERVIDPIEVEAPKKIPEKPPEPLIKPTRVITAPVRGGQQIYAQGGDLVVVAPVSPGAELLADGNIHVYGPMRGRALAGIKGDTKARIFCQQLSAELISIAGQYKVSEDLRRDPLWGSPVQVSLSGDVLNIIRL

minC

Probable septum site-determining protein MinC

246 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.395 kDa

MSQIESPNPEPVFQLKGSMLAITVMELARSNLEALDRQLAAKVAQAPNFFSNTPLILALDKLAPNEGPVDLPGLVRICRQHGLRTLAIRANRIEDIAAAIAVDLPVLPPSGARERVIDPIEAEAPKKLPEKPPEPLIKPTRVITSPVRGGQQIYAQGGDLVVVAPVSPGAELLADGNIHVYGPMRGRALAGIKGDTKARIFCQQLSAELISIAGQYKVSEDLRRDPLWGSPVQVSLSGDVLNIIRL

minC

Probable septum site-determining protein MinC

246 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.424 kDa

MSQIESQNPEPVFQLKGSMLAITVMELARTNLEALDRQLAAKVAQAPNFFSNTPLILALDKLAPNEGPVDLPGLVRICRQHGLRTLAIRANRIEDIAAAIAVDLPVLPPSGARERVIDPVEAEAPKKIPEKPPEPLIKPTRVITAPVRGGQQIYAQGGDLVVVAPVSPGAELLADGNIHVYGPMRGRALAGIKGDTKARIFCQQLSAELISIAGQYKVSEDLRRDPLWGSPVQISLSGDVLNIIRL

minC

Probable septum site-determining protein MinC

246 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.157 kDa

MASVNVDFEQAGELKIGQVGIANLRVRTLDVPRLVQEMRERVTRAPKLFGRAAVILDFGGLSQVPDLATAKALLDGLHEAGVLPVALAYGTSEIDLLSQQLGVPLLAKFRAQYESAAVSPPPPPPARAEPAPPAARPAPGRMQRTAVRSGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAELVAIAGNYKVLDDVPMDLRGKAVQVWLEQDQIKIAALD

minC

Probable septum site-determining protein MinC

245 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.266 kDa

MSQTEPLDQDPVFQLKGSMLAITVLELARNDLDALDRQLAAKVALAPNFFNNAPLVLALDKLPAGQGVIDLPGLMRVCRSHGLRTLAIRASRIEDIAAAIAIELPVLPPSGARERPLEPLVGEEKKKPEKPPEPTIKPTKIITSPVRGGQQIYAQGGDLVVISSVSPGAELLADGNIHVYGPMRGRALAGIKGDTKARIFCQQLTAELVSIAGQYKVSEDLRRDPLWGASVQVNLSGDVLNIIRL

minC

Probable septum site-determining protein MinC

245 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.213 kDa

MSQTEPKDQDPVFQLKGSMLAITVLELSRNDLDSLDRQLAAKVAQAPNFFSNAPLVLALDKLPPSEGAVDLPGLMRVCRQHGLRTLAIRASRIEDIAAAIAIDIPVLPPSGARERPLESAEPVAPKKPEKPPEPTVKPTRVITTPVRGGQQIYAQGGDLVVVSSVSPGAELLADGNIHVYGPMRGRALAGVKGDTKARIFCQQLSAELISIAGHYKVSEDLRRDPMWGSGVQVSLSGDVLNIIRL

minC

Probable septum site-determining protein MinC

244 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.401 kDa

MTAAVRSRPSLRFRGRSFHAMVLAPEVPVAAWFTDLDEWIQRSPGFFQGRPVVLDVSNLSLSRSALADLLQEFSARGIRIMGLEGADLSGHDLQMPPVLRGGRRENVIDLFAGEEAQASGKINSQIQEGDAHDVESAGALLIETPVRSGQSIMHLEGDVIVVGSVASGAEIIAGGSIHIYGALRGRAIAGAQGRKARIFCRKFEAELLSIDGYYMTADTVEPHLLGRPVQVWLEGDRLMVSIQD

minC

Probable septum site-determining protein MinC

244 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.926 kDa

MSNSLIFKSQMAQLNTVLIEERNLEVLYEQLTEKLAKAPEGFFKGAAMVAHLKAVDNVDLSWLMHLKTVFQKHHLLLVGVTQHPFDSETLFRAGLIDVPFLEPKSAKLEGEEEIKSVDLNEEIESSSPHFLSGAAHRKTLTVRHHVRSGQRIYAHGGDLVVIGTVNAGAEILADGNIHVLGTLRGKAFAGIKNNEDAHIFCLEMAAEIISIAGIYQNLEKNAHTTKNNCLITLNSDETMQITPL

minC

Probable septum site-determining protein MinC

243 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

28.612 kDa

MIILDINQNYKYFMFNKVCLKFKIKNFNILVIYLYDIKEKNIYKTIKNKIKNFSYFFKKMPCIINIKYLSEEDQYFWKYFHKKLSNLGLCIIGVSGCNNKIWEKIITRNGLLIFKEQINKKIFYEKKNKITKINNNYIIDKPIRSGQTIYAKKKNLIIMNTVNSGAEVIADGDIHIYGIMRGRASAGASKDTKSQIFCTKLYAEFISIAGKNWINENVLNSYLGKPVRFYIKNDILTIQKFSL

minC

Probable septum site-determining protein MinC

243 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.688 kDa

MILEVLMSQSVTIKSNKYGINLILDADMPFADLIKAVVEKFKASANFFKNAKLAISFEGRHLSDEEQQQIIAAIEENTTIEILCIVESGTEQEAIMKEQVEAFNEAVQKQCENVATVSVPEQFYRGTLRSGQVITSESSVTIIGDVNPGAKIIAQGNIVILGALKGNVHAGCTGDRSCFVFALDMQPIQIQIGDLIAKSPDEPQPKHRVRRKEKPAQEQAQIAIAKDGYIYIEPITKNILNSI

minC

Probable septum site-determining protein MinC

242 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.367 kDa

MQKMPIELKGSNFTFLVLYLNTNNVDLISKSLYKKIQEYPQFFKNVPVIVNVSNLLNQVNWKKIQEIIIEYGFYIVGVSGCKDNYFKKIIVESGLPVLLESNTTNTNKDLRSFYHTSTLKKTKNEQRLRVKKIEKTHIINTPVRSGQKIYAKYSDLVVINNVSAGAELVADGNIHVYGSVRGRVLAGANGDITSKIFCTTLFAELISVSGQYWLSDQIPSHFIGKSAQIYLKNKFLTINSLS

minC

Probable septum site-determining protein MinC

242 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.143 kDa

MNQVLTQSRPIRLKGRSFLALVLSPELPLDGWLDKLDDLAARSVGFFLNRPIVLDLENVSIERPQLVQLLEDLVKRGVWITGFENARPSLLGPGMPPAMRGGQPAADFDPEITEPKSQERTPVAPASVQLVKAVPSMVVTEPVRSGQSVYFPDGDVTIVGSVASGAEVVAGGSIHVYGALRGRAMAGTAGNADARIFCRKMEAELVAIDGLYKTAEDMESRLRGQAVQLWLDGDYMMAETLN

minC

Probable septum site-determining protein MinC

242 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.987 kDa

MSQADLLAQDPVFQLKGSMLAITVMELAHNDLDRLDAQLTEKVAQAPAFFSNTPLVLALDKLPEGEGELNLAELMAVCRRHGLRTLAIRASREGDIAAAEAMDLPVLPPSGARERLLDPAPKKVEEKPAEPEHKPSRIVTSPVRGGQQVYAQGGDLIVLAPVSAGAELLADGNIHVYAPMRGRALAGIKGNTKARIFCQQMGAEMLSIAGHYKVAEDLRRDPLWGDAVHVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

242 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.756 kDa

MTKVLTDQRSIRIKGRSFLAVVLSPESPVDQWLERLDDLAARSAGFFLSRPVVLDVSELSLDKAGLKELLAALRERNVGIMGIEGVRPSMIEPGMPPSLKGGKPASDVEVEPVAVAAELPEDKPHASGEVRAVVQSLVINEPVRSGQSIMFPEGDVTVIGSVASGAEIIAGGSVHIYGALRGRAMAGSLGNVSARIFCRKLEAELLAIDGVYKVAEDIDDKLRGQPVQLWLENDTIKAAKLG

minC

Probable septum site-determining protein MinC

242 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.936 kDa

MSAQAAAATAAALQFKGRMITVTLLRLLSPSLEAVGRELDARLADGSGLLAGLPTVLDLEALGESAAGLELAALAATLRAHGVSLIGLRELPGEAGEALRTRAEAAGLAVLNVDGSRAAPRREVEVSPRPAAEPVRSLLVTQPVRSGQQVYARGGDLILTAPVSAGAEVMADGNIHVYAPLRGRAMAGVLGDSGARIFCQRLDCELVAVAGHYRLSEQISDAERAGPVQVRLEGESLVIEAL

minC

Probable septum site-determining protein MinC

241 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.869 kDa

MSQADLPEPAPAFQLKGSMLAITVLELAHNDIERLDEQLAAKVEQAPDFFNNTPLVLALDKLPEASREIDIQALVALCRKHRLRTLALRASDAAHLEAAAALDLPVLPPSGARERKVDPSSKTPAKPAEPTYRPTRVVSTPIRGGQQVYAQGGDLVVLAPVSPGAELLADGNIHVYGPLRGRALAGIKGDTTARIFCRQLAAEMVSIAGQYKVAEDLRRDPLWAEAVQVSLSGDVLNITRL

minC

Probable septum site-determining protein MinC

241 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.716 kDa

MDQSSILDFRSGTFFAPILVLYNNDLEKIEQRLQEKIASAPDFFSSSPVLFDLSELNENDKKIDVEALISLLRRLSLFPVGIRGGDPSQEKRALELSVPVDSGRSRNDAILPEIQRKDDTMPEVQPVIREAVRAPAMMITQPVRSGQRIYAASDLVILAQVSAGAEIMAEGNIHVYNTLRGRALAGVQGDTAARFFCLDLQAELVSIAGIYKTSEDLKETPKKKPVQVYLRDQALIIEELS

minC

Probable septum site-determining protein MinC

241 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.819 kDa

MTKVITDPRSIRIKGRSFLAVMLSPDLPFDNWLIRLDDLAARSAGFFLGRPVVLDVTDLPIDRSQLKELIAELGQRNVSIMGIEGARPSILGPGMPAALKGGRAVSDFEVPEKEPTIELRSQPATVPEARPSVQSITIREPVRSGQSVIFPEGDVTVVGSVASGAEIVAGGSIHIYGTLRGRAMAGSLGKASAHIFCRKLEAELVAIDGIYKMAEDMPANLRGQAVQLWLEGDAIKAEKLI

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

27.661 kDa

MKNKLITFKNNNFTALVIYLENINFKYFKKFLLKKIQKSPIFFKNIPIALNIEKLAFNFNWINLKKFFFSIGLFLIGIFGCKKESVKLDILKSGLPILFKKKKTLLNFNKKKNFFNKNSNKNHYSSLFIKNQKSYLVNELIRSGQRIYAPNTDLIITNNVSPGAELIADGNIHIYGNMKGRALAGAHGDETRKIFCTKLSAELISIAGEYCTVDQIPIKFLENSVEISLVNKKIFIKYNH

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.116 kDa

MADIRITGRMVNFTRLTFDTNDHDAIRQQLTSILNEGSYQGTVVILDSTVEQELIALIQLLISLGLQPMAVIDGILSDEAKAIQFPVLPADQPLQRIKASKEEITVIATPKAADTTPETKTPITKTAIAHKTSYHDEILRTGQCLVQDHGDIILNAGMNSGSEVIASGNIHIYGNVRGRIIAGAGGNPSARIFCHALEAELVSIAGTYCVAEDIPKDVLKKSVHIYLNDNQELEFRALEF

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.041 kDa

MADIRITGRMVNFSRITFDTNDHDVIRQQLSNILNEGSYQGTVVIIDSTVEQELIALIQLLVSLGLQPMAVIDGILGDEARAIQFPVLPADQPLQRIKPTAEQVAIVEKPSSAQASVETKKPLNNNAVAHITSYHDEILRTGQSLVQDQGDIILKAAMNSGSEVIASGNIHIYGTVRGRVIAGAGGHAAARIFCQSLEAELVSIAGTYCVADDIPKHVVKKPVHIYLNEKQELEFEALEL

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.041 kDa

MADIRITGRMVNFSRITFDTNDHDVIRQQLSNILNEGSYQGTVVIIDSTVEQELIALIQLLVSLGLQPMAVIDGILGDEARAIQFPVLPADQPLQRIKPTAEQVAIVEKPSSAQASVETKKPLNNNAVAHITSYHDEILRTGQSLVQDQGDIILKAAMNSGSEVIASGNIHIYGTVRGRVIAGAGGHAAARIFCQSLEAELVSIAGTYCVADDIPKHVVKKPVHIYLNEKQELEFEALEL

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.045 kDa

MADIRITGRMVNFSRITFDTNDHDVIRQQLSNILNEGSYQGTVVIIDSTVEQELIALIQLLVSMGLQPMAVIDGILGDEARAIQFPVLPADQPLQRIKPTAEQVAIVEKPSSAQASVETKKPLNNNAVAHITSYHDEILRTGQSLVQDQGDIILKAGMNSGSEVIASGNIHIYGTVRGRVIAGAGGHAAARIFCQSLEAELVSIAGTYCVADDIPKHVVKKPVHIYLNEKQELEFEALEL

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.059 kDa

MADIRITGRMVNFSRITFDTNDHDVIRQQLSNILNEGSYQGTVVIIDSTVEQELIALIQLLVSMGLQPMAVIDGILGDEARAIQFPVLPADQPLQRIKPTAEQVAIVEKPTSAQASVETKKPLNNNAVAHITSYHDEILRTGQSLVQDQGDIILKAGMNSGSEVIASGNIHIYGTVRGRVIAGAGGHAAARIFCQSLEAELVSIAGTYCVADDIPKHVVKKPVHIYLNEKQELEFEALEL

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.059 kDa

MADIRITGRMVNFSRITFDTNDHDVIRQQLSNILNEGSYQGTVVIIDSTVEQELIALIQLLVSMGLQPMAVIDGILGDEARAIQFPVLPADQPLQRIKPTAEQVAIVEKPTSAQASVETKKPLNNNAVAHITSYHDEILRTGQSLVQDQGDIILKAGMNSGSEVIASGNIHIYGTVRGRVIAGAGGHAAARIFCQSLEAELVSIAGTYCVADDIPKHVVKKPVHIYLNEKQELEFEALEL

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.041 kDa

MADIRITGRMVNFSRITFDTNDHDVIRQQLSNILNEGSYQGTVVIIDSTVEQELIALIQLLVSLGLQPMAVIDGILGDEARAIQFPVLPADQPLQRIKPTAEQVAIVEKPSSAQASVETKKPLNNNAVAHITSYHDEILRTGQSLVQDQGDIILKAAMNSGSEVIASGNIHIYGTVRGRVIAGAGGHAAARIFCQSLEAELVSIAGTYCVADDIPKHVVKKPVHIYLNEKQELEFEALEL

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.533 kDa

MVERDNELKGTTFTISVLHISDGKPERIRQLLAAKVAQAPQFFNCAPLVINVERLTDIPDFEQLKELVESEDFVLVGITGAQSEAMKTAAKAAGLAVMASGKSRKAEPQPQPEPAPTPAPIVEVKAVPAPLVASKVHVGPVRSGQQLYAAGTSLVVLGSVSPGAEVIADDSIHIYGTLRGRAIAGAKGNPQARIYCQQLQAELLSIAGTFQLSDALPAGLIQQPVHVRLDNEQLRIDRIK

minC

Probable septum site-determining protein MinC

240 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.11 kDa

MSPVANAFDIKSASLDLLALLLRTDNLDELSQALDARFGDTSDAPAEAFVLDVEALPNPTELDLGRLLPLLSRRGIRAVALRHPDNALAAVASRYGLAFANSAAQPRSAQAAAEPAPKAAVESAAAPASAPTMIIDRPVRAGQQIYAKGGDLVVLAMVSAGAEVIADGNIHVYAPLRGRALAGARGNHAARIFARSMEAELVSIAGVYRTIEQALPDSILGKPTQIYLENERLVMTALGE

minC

Probable septum site-determining protein MinC

239 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.298 kDa

MADASIEFKGTSFTLSVLHLKTSKLADIRADLVKKVAQAPDFFYLVPVVVNIEQLDCSIDYQAVKTLIEEFNFTFVGFTGSVDKEQRKLIRELGFSFVNTTRVDTSQKAAIAEKAIVAESKVTAAIPECNLYTDKVHRGQIRSGQQIYAKDQNLVVIGSVSAGAEVIADGNIHVYGSLRGRAIAGAKGHHKAQIYCQNLEAELVSINGNYWLSESMEQHWGSPVYIHLTDSELTSSKLI

minC

Probable septum site-determining protein MinC

238 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.612 kDa

MLESVSVDLQGNNFTLLVIQTHTTCTSQIQLELTQKIKNSPSFFSNNTPVVINVENINHHDDWFNLYQTISNIGLFIIGVCCCYNKKLKNIITQSGLPILTKGNIIKSHKNTIKTNYTKPTFDDKTNAISKTQTIHTPIRSGQRIYARNRDLIIISNVSSGAEVIADGNIHIYGSVRGRVLAGASGCEQSQIFCTKLSPELISIGGYYWLNDQIPPEFLGKSARFYLQNHTLIIQHIS

minC

Probable septum site-determining protein MinC

238 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.094 kDa

MSNVNMDFEQAGELKIGQVGIATLRIRTLNVPRLIQEMSDRVTRAPKLFRRTAVILDFGELPHPPDLATAKALVEGLRAANVLPVAIAYGTNEIDLLSQQLGLPLLSKFRAHYERQEVAAPPPQSTPPISTGRIQHTTVRSGQQLYAEHCDLTILNTVGAGAEVIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAELIAIAGRYKVLDDIPTELRGKAVQVWLEQNQIKIAALD

minC

Probable septum site-determining protein MinC

238 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

26.155 kDa

MSNVNMDFEQAGELKIGQVGIATLRIRTLNVPRLIQEMSDRVTRAPKLFRRTAVILDFGELPHTPDLTTAKALVEGLRAANVLPVAIAYGTNEIDLLSQQLGLPLLSKFRAHYERQEVAAPPPQSTPPINTGRIQHTTVRSGQQLYAEHCDLTILNTVGAGAEVIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAELIAIAGRYKVLDDIPTELRGKAVQVWLEQNQIKIAALD

minC

Probable septum site-determining protein MinC

238 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.137 kDa

MSNVNMDFEQAGELKIGQVGIATLRIRTLNVPRLIQEMSDRVTRAPKLFRRTAVILDFGELPHPPDLTTAKALVDGLRAANVLPVAIAYGTNEIDLLSQQLGLPLLSKFRAHYERQEVAAPPPQSTPPINTGRIQHTTVRSGQQLYAEHCDLTILNTVGAGAEVIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAELIAIAGRYKVLDDIPTELRGKAVQVWLEQNQIKIAALD

minC

Probable septum site-determining protein MinC

238 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.094 kDa

MSNVNMDFEQAGELKIGQVGIATLRIRTLNVPRLIQEMSDRVTRAPKLFRRTAVILDFGELPHPPDLATAKALVEGLRAANVLPVAIAYGTNEIDLLSQQLGLPLLSKFRAHYERQEVAAPPPQSTPPISTGRIQHTTVRSGQQLYAEHCDLTILNTVGAGAEVIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAELIAIAGRYKVLDDIPTELRGKAVQVWLEQNQIKIAALD

minC

Probable septum site-determining protein MinC

238 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.275 kDa

MVERDNELKGTTFTISVLHISDGKPERIRQLLAAKVAQAPQFFNCAPLVINVERLADIPDFDQLKGLVESEDFVLVGITGARDEAMKTAAKAAGLAVMASGKSRKVEPLPLPEPTPSPVAEVKAAPAPLVPSKVHVGPVRSGQQLYAAGTSLVILGSVSQGAEVIADDSIHIYGALRGRAIAGAKGNTQARIYCQQLQAELLSIAGTFQLSDALPAGLIQQPVHVRLDNEQLRIDHIK

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.534 kDa

MQKKSIELKSNNFTLLVLYLNNQNIDLINQSLYKKIQECPKFFKNAPIIVNVSKLCNTVDWKKIKKIIISHGFFVVGVSGCQDGILKKNIIDSGLPILSERKNNKSNIITNFFINSYKNKKKETINKVEKTHIIDIPVRSGQKIYAKHADLIVINNVSAGAELVADGNIHVYGIVRGRVLAGANGDTSRKIFCTGLFAELVSISGEYWLSDQIPSEFIGKSAQIYLKNKFLTINSLS

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

26.534 kDa

MQKKSIELKSNNFTLLVLYLNNQNIDLINQSLYKKIQECPKFFKNAPIIVNVSKLCNTVDWKKIKKIIISHGFFVVGVSGCQDGILKKNIIDSGLPILSERKNNKSNIITNFFINSYKNKKKETINKVEKTHIIDIPVRSGQKIYAKHADLIVINNVSAGAELVADGNIHVYGIVRGRVLAGANGDTSRKIFCTGLFAELVSISGEYWLSDQIPSEFIGKSAQIYLKNKFLTINSLS

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.534 kDa

MQKKSIELKSNNFTLLVLYLNNQNIDLINQSLYKKIQECPKFFKNAPIIVNVSKLCNTVDWKKIKKIIISHGFFVVGVSGCQDGILKKNIIDSGLPILSERKNNKSNIITNFFINSYKNKKKETINKVEKTHIIDIPVRSGQKIYAKHADLIVINNVSAGAELVADGNIHVYGIVRGRVLAGANGDTSRKIFCTGLFAELVSISGEYWLSDQIPSEFIGKSAQIYLKNKFLTINSLS

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

26.268 kDa

MMVYIMNAFDIKSTKMDVLSISLHTSDLFDLEDVLVKLGKKFQESGVVPFVLDVQEFDYPESLDLAALVSLFSRHGMQILGLKHSNERWAAVAMKYHLLFCLSHSENVKELGQVEVQKTEDGQKARKTVLITSPVRTGQQVYAEDGDLIVTGAVSQGAELIADGNMHIYAPMRGRALAGAKGDTSARIFIHSMQAELVSVAGIYRNFEQDLPDHLHKQPVQILLQDNRLVISAIGSE

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.295 kDa

MMVYIMNAFDIKSTKMDVLSISLHTSDLFDLEDVLVKLGKKFQESGVVPFVLDVQEFDYPESLDLAALVSLFSRHGMQILGLKHSNERWAAVAMKYHLLFCLSHSENVKELGQVEVQKTEDGQKARKTVLITSPVRTGQQVYAEDGDLIVTGAVNQGAELIADGNMHIYAPMRGRALAGAKGDTSARIFIHSMQAELVSVAGIYRNFEQDLPDHLHKQPVQILLQDNRLVISAIGSE

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

26.207 kDa

MMVYIMNAFDIKSTKMDVLSISLHTSDLFDLEDVLVKLGKKFQESGVVPFVLDVQEFDYPESLDLAALVSLFSRHGMQILGLKHSNERWAAAAMKYHLLFCLSHSENVKELGQVEVQNTEDGQKARKTVLITSPVRTGQQVYAEDGDLIVTGAVSQGAELIADGNIHIYAPMRGRALAGAKGDTSARIFIHSMQAELVSVAGIYRNFEQDLPNHLHKQPVQILLQDNRLVISAIGSE

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

26.221 kDa

MMVYIMNAFDIKSTKMDVLSISLHTSDLFDLEDVLVKLGKKFQESGVVPFVLDVQEFDYPESLDLAALVSLFSRHGMQILGLKHSNERWAAAAMKYHLLFCLSHSENVKELGQVEVQKTEDGQKARKTVLITSPVRTGQQVYAEDGDLIVTGAVSQGAELIADGNIHIYAPMRGRALAGAKGDTSARIFIHSMQAELVSVAGIYRNFEQDLPNHLHKQPVQILLQDNRLVISAIGSE

minC

Probable septum site-determining protein MinC

237 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.207 kDa

MMVYIMNAFDIKSTKMDVLSISLHTSDLFDLEDVLVKLGKKFQESGVVPFVLDVQEFDYPESLDLAALVSLFSRHGMQILGLKHSNERWAAAAMKYHLLFCLSHSENVKELGQVEVQNTEDGQKARKTVLITSPVRTGQQVYAEDGDLIVTGAVSQGAELIADGNIHIYAPMRGRALAGAKGDTSARIFIHSMQAELVSVAGIYRNFEQDLPNHLHKQPVQILLQDNRLVISAIGSE

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.276 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDTSLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.246 kDa

MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPPQNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.188 kDa

MSNTPIELKGSSFTLSVVHLHDAKPEVIRQALEDKIAEAPAFLKHAPVVVNVSGLDAPVNWQHLQQAVSSTGLRIVGISGCKDAKLKNEIERAGLPLLNEGKEKTARSAPKEAPTPPPQTQTVTSVTKTRMIDVPVRSGQRIYAPNCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRDAQIFCTHLTAELVSIAGEYWLSDKIPAEFYGKAARLLLAENALTVQPLN

minC

Probable septum site-determining protein MinC

235 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.188 kDa

MSNTPIELKGSSFTLSVVHLHDAKPEVIRQALEDKIAEAPAFLKHAPVVVNVSGLDAPVNWQHLQQAVSSTGLRIVGISGCKDAKLKNEIERAGLPLLNEGKEKTARSAPKEAPTPPPQTQTVTSVTKTRMIDVPVRSGQRIYAPNCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRDAQIFCTHLTAELVSIAGEYWLSDKIPAEFYGKAARLLLAENALTVQPLN

minC

Probable septum site-determining protein MinC

234 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

26.084 kDa

MKILPIKIKGSIFTLLVLYLQNHPVELFKNNLRDKIKNFPTLFKNAPIAINVEKCSNEINWNNIKNAIISCGFNIIGVSGCKNGKLKNNIIKSGLPILSEGKEVFNFFNNINLDDKILSFEKKNYNKTPIFNSPIRSGQKIYANNSDLIITNNVNSGAEVIADGNIHIYGEVRGRVLAGAKGDNTCQIFCTKLFSELVAISGEYLLSGDFSEDTIGNSVKIYMKNKKLHIVKLN

minC

Probable septum site-determining protein MinC

234 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.571 kDa

MSEQIFELKGNLFTLSVLHLYSTDINLLAEQLYIKIAQAPKFFEGAPIVVNLIEIKNNSLDFVHLKSLLERMSFNAVGVCNGSDEQHTQAKAAGLSVLNYSQDVKSESVKKEPNTSIVEKTVHLPAQIINGTVRSGQQVYAKDRDLVVLGAVSHGAEVIADGNVHIYGTLRGRAIAGAKGFKNAHIFCNRLEAELVSINGNYWISDSLQGEHWGSAVQIQQKNESLEISALVKG

minC

Probable septum site-determining protein MinC

233 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.125 kDa

MSNTPIELKGSNFTLSVLHLNDGSPKVIRQAISDKIAQAPQFLKNAPVVINVSAIADQTIDFKKLRRIVEDAGLRVVGISGSHDAQQKEAIIAAQLPILNEGKITKPAAQANNDKTNEVPINVRQKTKIIHTPVRSGQRIYAPNSDLVVLSNVSAGAELIADGNVHIYGVLRGRVLAGASGDQESHIFCTHLSAELVSIAGQYWLSDQIPTDFVGKSVQLSLQENELTIENLI

minC

Probable septum site-determining protein MinC

233 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.732 kDa

MSQSPIELKGSSFTLSVVHLYNSEPEVIRQALQEKVEQAPAFLKNAPVVINVATLNGDANWKELQQAVTAAGLRVVGISGCRDERQKRAIARAGLPLLNEGKGQKMATPEPAPAPAPVVDPNAPAKTRIISTPVRSGQQIYARNSDLIVTSSVSAGAELIADGNIHVYGMMRGRALAGASGDTQCQIFCTHLGAELVSIAGQYWLSDQIPSDFVGQAVRLSLLDNALTIQPLN

minC

Probable septum site-determining protein MinC

233 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.053 kDa

MSNTPIELKGSSFTLSVVHLHDANPEVIRQALEDKIAQAPAFLRHAPVVVNIASVEEEVEWRAINEAIAATGLRIMGVSGCKIPRLKTEIDRAGIPLLTEGKEKAPRPAPSEPTPPPPPVANQITKTRLIDQPVRSGQRIYAPHCDLIVTNHVSAGAELIADGNIHVYGMMRGRALAGAGGDRDAQIFCTHLAAELVSIAGEYWLSDNIPAEFYGKAARLRLGESALTVQPLN

minC

Probable septum site-determining protein MinC

232 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

25.975 kDa

MTTQKKQAVTIKGTKDGLTFHLDDRCSFDSIVGELAEKLSSKHYQMEDQPRIQVKVDVGYRYLTVEQKRHIQELITDGRNLDVEEFVSQVMTKEEAEEKRKEAQIVSVAKVIRSGQVFSVDGDLLLIGDVNPGGTIRASGNIFVIGSLRGIAHAGYKGNGEAVIATSHMAPAQLRIGEQIFHWSKEEQQAGDRIMECAYIASDTNEIQLDRVQKLLKIRPNLATFLDEMVEQ

minC

Probable septum site-determining protein MinC

232 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.917 kDa

MSNTPIELKGSSFTLSVVHLHDANPEVIRQALEDKIAQAPAFLRHAPVVVNIASIEEEVEWRAINEAIAATGLRIMGVSGCKIPRLKTEIDRAGIPLLTEGKEKASRPAPSEPTPPPPVASQITKTRLIDQPVRSGQRIYAPHCDLIVTNHVSAGAELIADGNIHVYGMMRGRALAGAGGDRDAQIFCTHLAAELVSIAGEYWLSDNIPAEFYGKAARLRLGESALAIQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.006 kDa

MIHAPIDFKGSNFTLLVIHIYDAPIEVIIQAIQDKITQAPQLLKNAPVILNVASLSPECNWINLLKAILSTGLHVVAVSGCNNSTLKNDIIISGLPLITEGQTLQCSSYTTTPIKSTLSINNKTKLIHTPIRSGQQIYAKNSDLVITNNVSAGAELIADGNIHIYGMMRGRALAGASGDSHCQIFCSYLFPELVSIAGQYWIDDQIPAELLGKAGRIYLHCDALSIQPLIF

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.676 kDa

MEAAAKVQRQMVRLRGRSYVAFVFVPTVPILDWLQEIDATIARSPGFFAGRPVVIDLSSVDLSQSGINHLLTSLQDRNIRVLGIEGVEEGRLTPMMPPLLSGGRSCVVEPSAPKKVEKAEAKPTSLLLENPVRSGQTVIFPEGDVTILGSVGSGAEVVAGGSIHVYGALRGRAMAGVNGHTSARIYCQKIEAELLAIDGFYQTADDIDAALRGKPAQAWLQGNTMRITALN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.761 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKSPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.701 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEAPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.701 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEAPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.761 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKSPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.701 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEAPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.701 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEAPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.776 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPTQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.805 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALKDKIAQAPTFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTMPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

231 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.745 kDa

MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

minC

Probable septum site-determining protein MinC

230 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.813 kDa

MLAKVEPKRQLARFRGRSYVAFVFAPVVPIADWLEEIDSTIERSSGFFVGRPVVLDLSAVDLSCSGITHLLSSLEARNIRVLGIEGVNGSQLTPSMPPLLTGGRHCVLEHIETDKAEAKPRASSLLLKQPVRSGQSVVFTEGDVTVLGSVGSGAEIVAGGSIHIYGTLRGRAMAGVNGNLDARIYCQKIEAELLAIDGYYQTAENIDSTLRSRPVQAWLDDETLKITPLI

minC

Probable septum site-determining protein MinC

230 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.646 kDa

MSQSPIELKGSSFTLSVIHLHHTDPAIVRNALEEKVSQAPAFLKNAPVVINVAALSREINWRQMQQAILATGLHIVGVSGCKDERLKQTIARSGLPVLNEGKEQKNSADTPPIAALPVQTTAKTRLISTPVRSGQQIYAKDCDLIITSSVSAGAELIADGNIHIYGMMRGRALAGANGDKNCQIFCTSLSAELVSIAGNYWIMDQIPAEFFGKASRLCLQDGALTIQALN

minC

Probable septum site-determining protein MinC

230 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.646 kDa

MSQSPIELKGSSFTLSVIHLHHTDPAIVRNALEEKVSQAPAFLKNAPVVINVAALSREINWRQMQQAILATGLHIVGVSGCKDERLKQTIARSGLPVLNEGKEQKNSADTPPIAALPVQTTAKTRLISTPVRSGQQIYAKDCDLIITSSVSAGAELIADGNIHIYGMMRGRALAGANGDKNCQIFCTSLSAELVSIAGNYWIMDQIPAEFFGKASRLCLQDGALTIQALN

minC

Probable septum site-determining protein MinC

230 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.135 kDa

MSNTPIELKGSSFTLSVVHLHDAHPEVIRKALEEKIAQAPAFLKNAPVVVNVAGLDGSINWQQLHQTFIDSGLHLVGISGCQDDALKAEISRAGLALLTEGKASAPRAAKPAETPAPPAAALRTRLIDLPVRSGQRIYAPGADLVVTSHVSAGAELIADGNIHVYGTMRGRALAGAGGDKEAQIFSTNLAAELVSIAGVYWLSDQIPAEFYNKAARLRLADGALTVQPLN

minC

Probable septum site-determining protein MinC

229 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.407 kDa

MDENSVTFKGTVNGLTIILKNEPEFSEIIQCMRDKVNSAGKFFRGAKLAVKYKGRILNEEERSQLLEILVRESGARIEAFEEDKEQVQNVANNVSSDKPVERKNQIKKYMFFKGIEEGQTKFYRGTVRSGQLVNFDGNLVILGDVNPGAVIEATGNIVVMGLLRGVVHAGSDGNKEAIVVALGLNPTQLRIADIITRPPDEKGVVGNPIPELAYVKDDILYVERFLPTR

minC

Septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.59 kDa

MQDLKQIITIKGTRDGLSLFIDEDASFEEVLKELEEKIQFSKPKQDEPVVSVKVKLGNRYISGEKEEQIRQVITTDQRFKVIGIDSNLIPINDAKRWMDDSEVKVINRVVRSGQILEIQGDLLLVGDVNPGGRVVASGNIYILGNLLGIAHAGYHGDKDAFIAASYMKPTQLRIADYISRAPDYESDGVYMECGIIDTDQDKITIDSLKVLSKKRKEISGFERRMNNG

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.42 kDa

MSQMPIELKGSSFTLSVVHLHDSQPEVIYQALQEKIEQAPAFLKNAPVVINVAALTAETDWIKLQQAISSTGLHVVGVSGCTDDALKKIIAQAGLPLLSEGKAQRRVVEPVAAVPAAVKTQIIDTPVRSGQQIYARNCDLIVTSNVSAGAEVIADGNIHIYGMMRGRALAGVSGDVQSQIFCTHLAAELVSIAGRYWLSDQVPEAYFGQPARINLNQLDNVLTIKPLD

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.376 kDa

MSQTPIELKGSSFTLSVVHLHDSQPEVIYQALQEKIEQAPAFLKNAPVVINVAALTAETDWIKLQQAISSTGLHVVGVSGCTDDALKKTIAQAGLPLLSEGKAQRRVVEPVAAVPAAVKTKVINTPVRSGQQIYARNCDLIVTSSVSAGAEVIADGNIHIYGMMRGRALAGVSGDVQSQIFCTHLAAELVSIAGRYWLSDQIPEPYFGQPARINLNQLDNVLTIKPLD

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.155 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLIELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIKSDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.174 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLMELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.287 kDa

MDEKKQQNITIKGTKDGLTLHLDDCCSFTELLQELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGMVIAGGNIFVVGSLRGIAHAGYYGDKDAVIAASVMNPMQLRISDVTTRAPEEKEDGAETAECAYINEDNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.174 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLMELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.272 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYESDGRSLIEVRVKVGNRYLTEVQQEEIRTLIRNKKNLVVESIESDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVLGSLRGIAHAGYDGDSEAVIAASIMNPMQLRISDVTMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.453 kDa

MSQSPIELKGSSFTLSVIHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKMAPEPVVSPPENVPTKTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAQCQIFCTHLGAELVSIAGQYWLSDQIPSDYFGQAARLHLLDNALTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.546 kDa

MSQSPIELKGSSFTLSVVHLHDSRPEVIRQALQEKVDQAPAFLKNAPVVINVATLPNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLSEGKGQKLAPEPVISPPENVPTQTRIINTPVRSGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAELVSIAGQYWLSDQIPLEYFGQAARLYLQDNTLTIQPLN

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.229 kDa

MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLKELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKEEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV

minC

Probable septum site-determining protein MinC

228 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.989 kDa

MRQDIVIRGTTRTGLLLLLPDEGEFSAVLERLAERLASSGRFFVGGRVQVHVGNRRLSPEDREALEQTLQRSGMVLLSVKEGGDPLAEVQAPEAGAPSAPPPPAGNTLVVTKTVRSGQEIRHDGDVIILGDVNPGAVVVATGHIVVMGALRGVAHAGCTGNRTAIVAATKLRPTQLRIAEVIGRAPDGDAPQSYPEVARIRGDLIVVEASAEKRQVSALEAVGAKEDR

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.094 kDa

MSLREICSQELVEFKGNKRGIIVNIKREAPFEEIQEKIINKLEAYVGFFNGAKISKINSDCLTDMEILELKEGITSRFDVEFVEDQKIEENSNFPTKYVNTLRSGENIEFEGDVVILNDMKPGSKVLSKSNTVVMGDINAGAKVVAGGNVFVMGKIEGFVHAGAEGNEFAYVVAGNLNPKILQIADNIAEAPDDEENYESESEISPEIAFVSNGRIVIESYLSKLDK

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.1 kDa

MKTQKQQYVTIKGTKNGLTLQLNDDCSFDDLLSGLRELLLLEQYTDGREGHKVNVHIKLGFRYLTEDQEMRLTEAVSENEHLVIHSIESDVMSTEEAKRLKAEAEITSVAKIVRSGQVLYVEGDLLLIGDVNPGGTIRAGGNIFVLGALKGVAHAGCNGNKQAVIAASRMIPTQLRIAQVFNRAPDQKEDGNEMECAYLDIDGNMIIERLQQLAHIRPNLTRLEGGM

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.204 kDa

MTRGKSFVTIKGTKDGLTFLLDDRCSFDELIKELTDKLSANYYKSGEEERPVYVKMDLGNRYLNEEDKAQLEAVVTEGRNMRIEHYDSGVISWEEAQLMKEHAQTTTLTRMIRSGQVVHVKGNVLLVGDINPGGLLTATGSIYVMGALKGRAHAGFEGKRDARICAAMMAPAGLQIADESLYFVDKDEAVEDHMKAAFLDEVNGSIRIERVQRLLDVAAEINKEAVS

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.418 kDa

MSQSPIELKGSNFTLSVVHLHNDQPEIILQALQEKVEQAPDFLKNAPVVINISALPADADLKALHHAIDSAGFRIVGMSGCRDEQQRRAVIKASLPLLSEGKKQKTSAKEDKPAEPAIKKTRVINLPVRSGQRIYAQGSDLIVTSNVSAGAELIADGNIHIYGMMRGRALAGASGDQECLVFCTHLNAELISIAGQYWLGDKIPTELAGKAAKLSLVNNELTIEPLI

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.407 kDa

MSEGSVIFKGSLNGLTIIMKEEEDYDSILKQIEDKIASSGRFFKGAILSVKYRGKKLTEEQERKLFELLRDKSGAKIKSLEEDTEEPVKPEPVQQQPRFRSKIRMSNFYFKGLEEGITKFHRGTVRSGQLVSFDGNLVIIGDVNPGGEVCATGHVIVMGSLRGMVHAGANGNREALVVALNLQPTQLRIADVITRPPDEKETVGQFFPELAYIKDGMVYIERYLPAR

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.27 kDa

MAKQKQQYVTIKGTKDGLTLHLDDRCSYDDLLKEIEERLVKQAGVAPDSPLVSVHLKIGNRYLTPAQEEEVRALIRRSKNLVVDSIESNVMSKAEAIEWMRKTEIVPVSRIVRSGQVLHVEGDLLLIGDVNPGGTVIAGGNIFILGALRGIAHAGYAGNKQAIIVASVMKPMQLRIGDIMSRAPDSKTDEGNEMECAYIDEHNQIVVDRLQLLMHLRPNLTRLERRM

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.447 kDa

MAKQKQQYVTIKGTKDGLTLYLDDRCSYDDLMKEIEERLVKRSSVAANSPLVSVHLKVGNRYLTPAQEEELRALIRRSKNLVVDSIESNVISKAEAIEWVQKTEIVTVSRIVRSGQVLHVEGDLLLLGDVNPGGTVIAGGNIFILGALRGIAHAGYAGNKEAIIAASVMKPMQLRIGDVMNRAPDYKTDERNEMECAYINEHNQIVVDRLQLLMHLRPNLTRLERRM

minC

Probable septum site-determining protein MinC

227 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.551 kDa

MSASADHTFDIKSARLNLFSIRLRSTRLADITRDLDNRFSADSPFSRTPAMLDVSQVNPVELDYRGLVARFAQYGIHLVGVRPTPAGLEGALDDAGLLPLGGDEALDESRLEDEPQPQTLVIDKPVRAGQQVYARGGNLVVLATVSAGAEVIADGDIHIYGSLRGRALAGARGQRDARIFVRSMQAELLSIAGIWRTLEQDLPAALASRPLQVLLESDKIVMRALPD

minC

Probable septum site-determining protein MinC

226 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.653 kDa

MSQAPIELKGSSFTLSVVHLHNSQPEVIRPALIAKVGQAPAFLKNAPVVINITDVNGSVEWHEMLRMFSAAGLHVIGVSGCRDETQKQAVLHAGLPLLSEGKGAVKKAPVAPATPVAAKTKIISTPVRSGQQIYARSGDLIVTSHVSAGAELIADGNIHVYGIMRGRALAGAAGDSGSQIFCSHLSAELVSIAGQYWLSDQIPENYYGQAAHLTLSSGALTIQSLF

minC

Probable septum site-determining protein MinC

226 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.653 kDa

MSQAPIELKGSSFTLSVVHLHNSQPEVIRPALIAKVGQAPAFLKNAPVVINITDVNGSVEWHEMLRMFSAAGLHVIGVSGCRDETQKQAVLHAGLPLLSEGKGAVKKAPVAPATPVAAKTKIISTPVRSGQQIYARSGDLIVTSHVSAGAELIADGNIHVYGIMRGRALAGAAGDSGSQIFCSHLSAELVSIAGQYWLSDQIPENYYGQAAHLTLSSGALTIQSLF

minC

Septum site-determining protein MinC

226 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization. The MinCD complex plays an important role in asymmetric septum formation during sporulation of B.subtilis cells.

Belongs to the MinC family.

24.998 kDa

MKTKKQQYVTIKGTKNGLTLHLDDACSFDELLDGLQNMLSIEQYTDGKGQKISVHVKLGNRFLYKEQEEQLTELIASKKDLFVHSIDSEVITKKEAQQIREEAEIISVSKIVRSGQVLQVKGDLLLIGDVNPGGTVRAGGNIFVLGSLKGIAHAGFNGNNQAVIAASEMLPTQLRINHVLNRSPDHIQKGNEMECAYLDTDGNMVIERLQHLAHLRPDLTRLEGGM

minC

Probable septum site-determining protein MinC

226 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.998 kDa

MKTKKQQYVTIKGTKNGLTLHLDDACSFDELLDGLQNMLSIEQYTDGKGQKISVHIKLGHRYLYQEQAEKLTDLIASKKDLVVHSIDSEVIAKEEAQRMKEEQEIVSVSKIVRSGQVLHVTGDLLLIGDVNPGGTIRAGGNIFVLGSLKGIAHAGYNGNNRAVIAASEMMPTQLRINHVLNRSPDHIQKGNDMECAYLDTDGNMVIERLQQLAHLRPDLTRLEGGM

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

25.21 kDa

MAQDIVAFRTGQFSSIFLTLHSSSLSVIKRALSKKIKSSPSIFQHIAVILQFTPELEKVNLQALKSLCEEFNIHIIGVSDWTNHLQKELIMTSGLALLGKSGEFTEILPEPRCLPVKIIHQHVASKQVIYAKNSDLIIHGNVEPGAEVAADGNVHIYGKLLGRAMAGVNNNVGSIYTQYLDAEFIAVSSRFLYKDNLPHEYQHEAVRIFADKDKLRFHFLLEKET

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.685 kDa

MEIEVGEPEAQRLKLPWCREAHWRETLPAMLNELDPGPIELDCRDWQLGCRDLHQLRELLNKEGVTLTRIHANLRETLVSAAALGYPTHMASPQGNSSKTRSSDTQPKPKTPQKLLFHQGTLRSGDHLSAEGDVLLLGDVNPGARISAGGDVMVWGRLRGIAHAGQDGDTKAKIVALQLRPLQLRIADAVARGPEDQPQPGLAEEARLEGDTIMIEPARANRFNG

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

25.003 kDa

MKKNVQIKGTKSGISIFLSDKASISELQQELSQLLADQKQNPYSGEKLEVQVQIGNRLFSEEEEREISTIIHNNSQMKISAFYSNVMSKDEAKKWKENDQIFSMATIIRSGQVVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGDENAVVAGKFLYPSQVRIAGKVYGFDSEDYKEVADTDLFSAFVNDAGEIVIDEIHKIRKIRPEISNFQGGR

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.031 kDa

MKKNVQIKGTKDGISIFLSDKASISELQQELTQLLADQKQNPYSGEKLEVQVQIGNRLFSEEEEREISTIIHENSQMKISAFYSNVMSKDEAKKWKENDQIFSMATIIRSGQVVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGNGNAIVAGKFLYPSQVRIADKVYGFDSEDYKEVTETDLFSAFVNDAGEIVIDGIHKIRKIRPEISNFQGGR

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.031 kDa

MKKNVQIKGTKDGISIFLSDKASISELQQELTQLLADQKQNPYSGEKLEVQVQIGNRLFSEEEEREISTIIHENSQMKISAFYSNVMSKDEAKKWKENDQIFSMATIIRSGQVVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGNGNAIVAGKFLYPSQVRIADKVYGFDSEDYKEVTETDLFSAFVNDAGEIVIDGIHKIRKIRPEISNFQGGR

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.056 kDa

MKKNVQIKGTKDGISIFLSDKASILELQQELTQLLADQKQNPYSGEKLEVQVQIGNRLFSEEEEREISTIIHKNSQMKISAFYSNVMSKDEAKKWKENDQIFSMATIIRSGQVVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGNENAVVAGKFLYPSQVRIAGKVYGFDSEDYKEVTETDLFSAFVNDAGEIVIDGIHKIRKIRPEISNFQGGR

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization (By similarity).

Belongs to the MinC family.

25.047 kDa

MKKNVQIKGTKDGISIFLSDKASISELQQELTQLLADQKQNPYSGEKLEVQVQIGNRLFSEEEELEISTIIHENSQMEISAFYSNVMSKDEAKKWKENDQIFSMATIIRSGQVVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGNENAVVAGKFLYPSQVRIADKVYGFDSEDYKEVTETDLFSAFVNDAGEIVIDGIHKIRKIRPEISNFQGGR

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

25.217 kDa

MKKNVQIKGTKDGISIFLSDKASILELQQELSQLLADKKQNPYSGEKLEVQVQIGNRLFSEEEELEISTIIHNNSQMEISAFYSNVMSKDDAKKWKERDQIFSMATIIRSGQVVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGDKNAVVAGKFLYPSQVRIADKVYGFDSEDYKEVVDTDLFSAFVNDTDEIVIDEIHKIRKIRPEISNFQGGR

minC

Probable septum site-determining protein MinC

225 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.735 kDa

MSQTPIELKGSNFTLSVIHVHDAQPEEIRRAIEEKVEKAPGFLKNAPVVINVAGLGRDTSWEALSQAVLATGLHIVGVSGCSDSKLKQAIVRSGLPLLTEGKAPKRSVDATPALAAVKTRLINTPVRSGQQIYARSSNLIVTSSVSAGAELIADGNIHIYGMMRGRALAGASGDGECQIFCTHLSPELISIAGQYWLSDQIPAALLGKAARLCLQDGTLTIHPLI

minC

Probable septum site-determining protein MinC

224 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.594 kDa

MRKASLELKGSSFTLSVLHINTSDLDSITLDLDKKLAQAPQFFIGAPLVLNLSAVEDGKLDLAALKDLLVSRQLVIVGVTGASEALSEQAKACGLASVKAGKQTQMPSPPSEPRTTRIVRQNVRSGQQIYVKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGANGERDAVILASHLEPELISIAGQYWLTENLQKHGVTAKSGCVRLDGDSLTVEALPL

minC

Probable septum site-determining protein MinC

222 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.448 kDa

MKKQLVNMKGTKDGFVLRLDDQCAYSDLVEELKKKVLEGGIDGKVDVQLYLGYRYCTDEQIDELIHIVQETEQLIVASVQSEVLTVHESNQKMIESQQDTYLGVVRSGQILRSSGDIIIVGNVNPNGRVEAGGNVYVLGKLKGIVHAGVQGNKEAIIAASQFEATHIMIADQVEAMSDEHVKEINQAEMTCAFIGYDGRITYDQIHALKNIRPLLNVSKGGS

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.988 kDa

MSLNNLNKKENFISIQLLSENWAEELRLSIKGYQKGFIKINSGALPLTCKDINELKRICNGVGMEIISIESTNAESIVSASALGLNANLKLKDNVFTEVKSDFKDLSESKVNAALLFHKGTLRSGEVLEADEDILILGDVNPGATVLAGGNVMIWGRLLGIAHAGKYGNNQAKITALQLRPVQLRIANKIARGPKEKPELGLAEEATIQEEVIVIKPARTT

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.12 kDa

MSKPSLELKGASFTLSVLHINSSDLQAVMTELDSKLAQAPQFFLGAPLVVNLSAIQHDSLNLSALKDLLISRQLVIVGITGATTVLSKQAKDLGLAIVKAGKQSSTPPPAPRQTKIVKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDTSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLDGESLMVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.12 kDa

MSKPSLELKGASFTLSVLHINSSDLQAVMTELDSKLAQAPQFFLGAPLVVNLSAIQHDSLNLSALKDLLISRQLVIVGITGATTVLSKQAKDLGLAIVKAGKQSSTPPPAPRQTKIVKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDTSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLDGESLMVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.12 kDa

MSKPSLELKGASFTLSVLHINSSDLQAVMTELDSKLAQAPQFFLGAPLVVNLSAIQHDSLNLSALKDLLISRQLVIVGITGATTVLSKQAKDLGLAIVKAGKQSSTPPPAPRQTKIVKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDTSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLDGESLMVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.12 kDa

MSKPSLELKGASFTLSVLHINSSDLQAVMTELDSKLAQAPQFFLGAPLVVNLSAIQHDSLNLSALKDLLISRQLVIVGITGATTVLSKQAKDLGLAIVKAGKQSSTPPPAPRQTKIVKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDTSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLDGESLMVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.79 kDa

MSKQSLELKATSFTLSVLHIKNHDLIALAAELDQKLSQAPQFFIGAPLVINLKAVEKHCLDLSALKTLLMDRQLIIVGITEASPELIEQARALGLAVIKSGKQATTAPLPQRETKVVKQNVRSGQQIYAKNADLVIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDHNSVIIANSLEAELVSISGQYWLAEHLQQHSLDKRACIRRDGESLMVETLPQ

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.773 kDa

MAKQNLELKATSFTLSVLHINHNDLDIIAAELDNKLAQAPQFFLGAPLVLNLSAIQHTHIDFNALKQLLIDRNLIIVGITDASAEQIEQAKSMAIAVVKSGKQARKAELPERATKIVKQNVRSGQQIYAQNADLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDNQSVIIANSLEAELVSIAGQYWLTEHLQQYDLSQRGCVRLEGASLTVESLPQ

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.234 kDa

MQTPSLELKGSSFTLSVLHINSNDMAVIAAELDAKLAIAPQFFLGAPLVVNLSAIQATDFDILGLKEILTNRQLIIVGITSACPELTKQAKSIGLATVKTGKEATSQPQMPKTTKIVKQNVRSGQQIYAKNADLIIVGAVGNGAEVIADGSIHIYGTLRGKAMAGAGGDRHAVIMAQKIEAELVSIAGQYWLTENLQQNGAALSGCIRLEGESLTVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.119 kDa

MQKPSLELKGSSFTLSVLHINDADLDGVARELDDKLAIAPQFFLGAPLVVNLSAISDPDYNLAGLKDLLISRQLVIVGITGAPSAIANQAKALGLALIKSGKQSQTQPQLPKTTKIVKQNIRSGQQIYAQNGDLIIIGAVGNGAEVIADGSIHIYGSLRGKAMAGANGDKNAVIIAQNIDAELVSIAGQYWLTENLQAHASIKSGCIRLDGDSLTVEALSL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.121 kDa

MSKPSLELKGATFTLSVLHINSSDLNAVMAELDSKLAQAPQFFLGAPLVVNLSAIQDSNFNLRGLKELLLSRQLVIVGITGATTVLSNQAKTLGLAIVKAGKQTASPPPAPRQTKVLKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDTTAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLNGESLIVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.21 kDa

MSKPSLELKGASFTLSVLHINSSDLNAVMAELDSKLAQAPQFFLGAPLVVNLSAIQHNDFNLHGLKELLLSRQLVIVGITGATTVLSKQAKDLGLAIVKAGKQSTTPPPAPRQTKIVKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDPTAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLNGESLMVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.17 kDa

MQTPSLELKGSSFTLSVLHINSQDMAVIAAELDSKLAIAPQFFLGAPLVVNLSAIKASDFDLLGLKEILTSRQLIIVGITSALPVINDMAKSIGLAIVKSGKAATNQPQMPKTTKIVKQNVRSGQQIYAKNGDLIVIGAVGNGAEVIADGSIHVYGALRGKAMAGAAGDRNAVIVAQKIEAELVSIAGQYWLTEHLQQNEAAQSGCIRLEGDSLTVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.088 kDa

MSKPSLELKGASFTLSVLHINSSDLNAVMAELDSKLAQAPQFFLGAPLVVNLSAIQDNDFNLHGLKELLLSRQLVIVGITGATTALSNQAKTLGLAIVKAGKQSVTPPPAPRQTKVLKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDSSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLNGESLIVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.285 kDa

MQTPSLELKGSSFTLSVLHINSIDLEKVAKELDSKLAIAPQFFIGAPLVVNLSSISDSSYNLAALKDLLTSRQLVIVGITAAINTLSEQAKTLGLAIIKSGKQAQSQPQLPKTTKLVKQNVRSGQQIYAKNGDLVVIGTVGNGAEVIADGSIHIYGTLRGKAMAGASGDKHAVIIAKTMEAELVSIAGQYWLTDNIQANSTTKSGCIRLDGESLTIESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.1 kDa

MSKPSLELKGASFTLSVLHINSSDLNAVMAELDSKLAQAPQFFLGAPLVVNLSAIQDNDFNLHGLKELLLSRQLVIVGITGATIALSNQAKTLGLAIVKAGKQSVTPPPAPRQTKVLKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDSSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLNGESLIVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.1 kDa

MSKPSLELKGASFTLSVLHINSSDLNAVMAELDSKLAQAPQFFLGAPLVVNLSAIQDNDFNLHGLKELLLSRQLVIVGITGATIALSNQAKTLGLAIVKAGKQSVTPPPAPRQTKVLKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDSSAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLNGESLIVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.21 kDa

MSKPSLELKGASFTLSVLHINSSDLNAVMAELDSKLAQAPQFFLGAPLVVNLSAIQHNDFNLHGLKELLLSRQLVIVGITGATTVLSKQAKDLGLAIVKAGKQSTTPPPAPRQTKIVKQNIRSGQQVYAKNGDLIIFGAVGNGAEVIADGSIHIYGALRGKAMAGAAGDPTAVIIAHSLEAELVSIAGQYWLAENLQQHSSDKSGCIRLNGESLMVESLPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.562 kDa

MQTPSLELKGSSFTLSVLHINQLDLEKVTIELDGKLAIAPQFFLGAPLVVNLSRIKAPDYNLAALKDLLISRQLVIVGITEAIDEIATQAKALGLANIKSGKQSNTQPQLPKTSKIVKQNVRSGQQIYAKNADLVIFGTVGNGAEVIADGSIHIYGNLRGKAMAGASGDKHAIIIARSLEAELVSIAGQYWLAENIQHNSTTKSGCVRLEGESLTIEALPL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.892 kDa

MTKTADLKGSNFTLSVLHLPNDDVALALSMLEQKVAQAPSFFASAPVVVNIENVSNEINFVELKSGVERTGMIPVGITGCKDKQKQAQATAAGFAVMTSFTPQQVTQKANMQPTKVVKTPIRSGQQIYAKDADLVILNHVSPGAEVIADGSIHIHGTLRGRAIAGASGQAEAKVFCKNLQAELISIAGNYWLSDQIDKEYWHQNVMITMVEDRIQIDTLTL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.948 kDa

MTKTADLKGSNFTLSVLHLPNDDVALALNMLEQKVAQAPSFFASAPVVVNIENVSNEINFVELKSGVERTGMIPVGITGCKDKEKQAQATAAGFAIMTSFTPQQVTQKANMQPTKVIKTPIRSGQQIYAKDADLVILNHVSPGAEVIADGSIHIHGTLRGRAIAGASGQAEAKVFCKNLQAELISIAGNYWLSDQIDKEYWHQNVMITMVEDRIQIDTLTL

minC

Probable septum site-determining protein MinC

221 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

24.046 kDa

MTKTADLKGSNFTLSVLHLPNDDITQALSMLEQKVAQAPSFFASAPVVINIENVSNEINFVDLKLGVERTGMIPVGITGCKDKEKQAQATSAGFAVMTSFTPQQVTQKANMQPTKVVRTPIRSGQQVYAKDADLVILNHVSPGAEVIADGSIHIHGTLRGRAIAGASGQKEAKIFCKNLQAELISIAGNYWLSDQINKEYWHQNVMVTMVEDHIKIDTLTL

minC

Probable septum site-determining protein MinC

220 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.

23.872 kDa

MTKMAELKGSSFTLSALHLVDGDIKKATDYLKEKVNQAPNFFASAPVVIDITQAGREINFKQLKEDVKDAGMIPVGVSGCKDARMQNEAKSAGFAIMNAARQAKDMPVTVEPTRIIRTPVRSGQQIYAKNCDLVVMNHVSAGAEIIADGCIHVYGNLRGRAIAGASGQHQAQIFCQNIQSELISIAGNYWLSDKIKAEFWGKGVVISLAENNLNIEHLTL

minC

Probable septum site-determining protein MinC

220 amino acids

Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization.

Belongs to the MinC family.