Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization. The MinCD complex plays an important role in asymmetric septum formation during sporulation of B.subtilis cells.

Belongs to the MinC family.

226 amino acids

MKTKKQQYVTIKGTKNGLTLHLDDACSFDELLDGLQNMLSIEQYTDGKGQKISVHVKLGNRFLYKEQEEQLTELIASKKDLFVHSIDSEVITKKEAQQIREEAEIISVSKIVRSGQVLQVKGDLLLIGDVNPGGTVRAGGNIFVLGSLKGIAHAGFNGNNQAVIAASEMLPTQLRINHVLNRSPDHIQKGNEMECAYLDTDGNMVIERLQHLAHLRPDLTRLEGGM

25 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make minC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here