mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

41.002 kDa

MSLQHFIQNALSNWMRQEGPESDIVLSSRIRLARNLDKVRFPTLFSNEEASAIIALFEEQFTGYEVPGIGKFELVKMDQVQPLEKRVLVEKHLISPHLTEASFGACLLSENEEVSIMLNEEDHIRIQCLFPGFQLSEALKAANQVDDWIEDRIDYAFSEQRGYLTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEALGNIFQISNQITLGKSEHDIVEDLNSVVAQLIEQERSARKALYQTSQIELEDRVYRSYGVLSNCRMIESKETARCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIRRAALIRERLKLENNGNRQEDETI

mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

41.044 kDa

MSLQHFIQDALSQWMKQKGPESDIVLSSRIRLARNLEHVRFPTQFSQEEAQAVLQQFEQKFASQEVKDIGNFVLIRMNETQPLAKRVLVEKHLISPNLAESRFGGCLLSENEEISVMLNEEDHIRIQCLFPGFQLANALKAANQIDDWIEEQVDYAFSEKRGYLTSCPTNVGTGIRASVMMHLPALALTRQMNRIIPAINQLGLVVRGIYGEGSEAIGNIFQISNQMTLGQSEEDIVDDLNSVTAQLIEQERSARKALYQTSKIELEDRVYRSLGILSNCRMIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALEPNERDIKRAAIIRERLRLEMHRNGQEDETI

mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system, where it is involved in regulating the global heat shock repressor CtsR; phosphorylates arginine residues in the winged helix-turn-helix domain of CtsR, thereby preventing its binding to DNA and consequently inducing the expression of repressed genes. The transcriptional repressor HrcA, the chaperone GroEL, the unfoldase ClpC, together with several ribosomal subunits, represent other physiological targets of McsB under stress conditions. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity. Functions as an adapter whose kinase activity is required for ClpCP-mediated degradation of CtsR during heat stress. Is required for the delocalization of competence proteins from the cell poles, probably via a role in the degradation of anchor proteins.

Belongs to the ATP:guanido phosphotransferase family.

41.124 kDa

MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRYSNEEASSIIQQFEDQFSEQEIPGIGKFVLIRMNDAQPLEKRVLVEKHLISPNLTESPFGGCLLSENEEVSVMLNEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGYLTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQISNQITLGKSEQDIVEDLNSVAAQLIEQERSAREAIYQTSKIELEDRVYRSYGVLSNCRMIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIRRAALIRERLHLEMNGKRQEDESI

mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.965 kDa

MSLKHFIQDALSNWMKQKGPESDIVLSSRIRLARNFENIKFPARYTNEEASSIIQQFEDHFSGKELPDIGQFHLIRMSEAQPLEKRVLMEKHLISPNLTESPFGGCLLSENEEVSIMLNEEDHIRIQCLFPGFQLLNAIKAANQVDDWIEEKVDYAFGEKRGYLTSCPTNVGTGLRASVMMHLPGLVLTRQMNRIIPAINQLGLVVRGIYGEGSEALGNIFQISNQITLGKSEQDIVDDLNSVAAQLIEQERSAREALYQTSKIELEDRVFRSYGVLSNCRMIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDARRAALIRERLHLEMSANRQEDDSI

mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.874 kDa

MSFEKFFNTAVSAWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLFSSEEAMQIVALFERTFAHRSYGGAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPFGACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEGYVNYAFDERLGYLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIFQISNQITLGKSEEDIVADLHTIVQQLIAQERAARQALVKTLGIQLEDKVFRSYGILANCRVIESKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGALRPEERDVRRAALIRERLKMEERRKMEGDER

mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system, where it is involved in regulating the global heat shock repressor CtsR; phosphorylates arginine residues in the winged helix-turn-helix domain of CtsR, thereby preventing its binding to DNA and consequently inducing the expression of repressed genes. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity. Acts exclusively on Arg residues, since it cannot phosphorylate Tyr, Ser, Thr, His, Asp and Lys. Has no free arginine kinase activity.

Belongs to the ATP:guanido phosphotransferase family.

40.853 kDa

MSFGKFFNTAVSAWMSQEGPNSDIVLSSRIRLARNIVDFRFPTLFSSEEAKQIVALFERAFVHRPYGEAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPFGACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEGHVNYAFDERLGYLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIFQISNQITLGKSEEDIVADLHTIVEQLIAQERAARQALVKTLGIQLEDKVFRSYGILANCRVIDSKEAAQCLSDVRLGIDLGYIKNVSRNILNELMILTQPGFLQQYAGGVLRPEERDVRRAALIRERLRMETRRKMEGDER

mcsB

Protein-arginine kinase

363 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.874 kDa

MSFEKFFNTAVSAWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLFSSEEAMQIVALFERTFAYRSYGGAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPFGACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEGHVNYAFDERLGYLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIFQISNQLTLGKSEEDIIADLHTIVQQLIAQERAARQALVKTLGIQLEDKVFRSYGILANCRVIESKEAAQCLSDVRLGIDLGYIKNVSRNILNELMILTQPGFLQQYAGGALRPEERDVRRAALIRERLKMEERRKMEGDER

mcsB

Protein-arginine kinase

362 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

41.133 kDa

MSFEKFFNTAVSSWMSQEGPDSDIVLSSRIRLARNIVDFQFPTVFNNEEAQQIVSLFEQTFAHRFYPSVGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPFGACLLSENEEISIMINEEDHIRIQCLFPGLQLTEALKVANELDDWIEEHVNYAFDEKLGYLTSCPTNVGTGMRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIFQISNQITLGKSEEDIVEDLKSVVQQLIAQERMARETLVKTLNIQLEDRVFRSYGILANSRVIESKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGVLRPEERDVRRAALIRERLKMEERKAMEGDE

mcsB

Protein-arginine kinase

359 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

40.395 kDa

MSIKKLFAETFLAWMNGETASQSDIVISSRVRLARNLSDIAFPHLLNQESGQKFMQLIYEAWQKSEFKELKQMELVTFENLSALDRKILVEKHLISPNHAQSTAFYQGLLVKPDGSLAVMINEEDHLRIQCFLPGLQLEEAYRRAQEIDDALEKELDFAFDDRRGYLTSCPTNIGTGMRASLMLHLPAITISGQSGHIFQNLNQLGLTVRGIYGEGTEAIGNFFQLSNQITLGQSEEDINASLTTISQQVIEQERMLRKSLREQMKYQLEDRIGRAYGILTHARLISSNEALTLLSDVRLGVDMGMIPRISPNALNELVVDIRPAHLQKKAGSDMDAVSRDAKRAEVIREKLQTGEEGS

mcsB

Protein-arginine kinase

358 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.099 kDa

MSLDRFLKNAISPWMKKDGSDADIVLSSRIRLARNMSAFTFPMLSSKEEAYAVAKHVKDALGGTQGEALGKAEMLAMEDMRTNDKRMLVEKHLISPHLAEQSKYGMVLLSGDESLSIMINEEDHIRIQSLSAGFELENCLQAANAVDDWVESHLTYAYDSQYGYLTSCPTNVGTGMRASVMIHLPALAMTRQLQRILPAINQLGLVVRGIYGEGSEALGNLFQISNQITLGKTEQDIVDDLQGVVKQLIRQERVARDSLLQHSKLELKDRVFRSYGILANSYIIDSKEATRRLSDVRLGIDLGFIENTAGKILDELMILTQPGFLQQYAKTVLTPEQRDERRAALIRERLKLEHETAD

mcsB

Protein-arginine kinase

358 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

40.142 kDa

MTLPNDLLETLVKRKESPQANKVWPVTTFSLARNLSVSKFLPCLSKEQKLEILQFITSHFNHIEGFGEFIVLPLKDTPLWQKEFLLEHFLLPYDLVGNPEGEALVVSRSGDFLAAINFQDHLVLHGIDFQGNVEKTLDQLVQLDSYLHSKLSFAFSSEFGFLTTNPKNCGTGLKSQCFLHIPALLYSKEFTNLIDEEVEIITSSLLLGVTGFPGNIVVLSNRCSLGLTEELLLSSLRITASKLSVAEVAAKKRLSEENSGDLKNLILRSLGLLTHSCQLELKETLDALSWIQLGIDLGLIKVTENHPLWNPLFWQIRRAHLALQKQAEDSRDLQKDTISHLRASVLKELTKGLSPESF

mcsB

Protein-arginine kinase

357 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

40.685 kDa

MSQKQFMQNPWSNWMKGEGPDSDIVISTRLRIARNLRQHPFPLLATDSQAEEVVRKVTEVSDSEAMRKRHQLQVIHMDQINPLEKRVLVEKHLISPHLAEESRKGAVLLREDESVSIMVNEEDHIRIQVLLPGFRLNEAWEIGTKIDDIFEKSLNYAFDETRGYLTSCPTNVGTGIRASVMLHLPALVMTQQISRILQAINQVGLVVRGIYGEGSEALGNLFQLSNQVTLGMSESDILSNLYGVARQIIEQERVARTYLLEHTRVSLEDRIFRSYGILMYARTVESKEAAQRLSDVRLGIDLGIIPNVSPLVLNELLVTTQPGFLQHHAGQKLTPDQRDERRARLIRERLRVVESQE

mcsB

Protein-arginine kinase

357 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.884 kDa

MSLKETVSNPYSKWLEATGPENDVIISSRVRLARNLMGYPFPHVLGHENADKVLYAVQSAVAQKSLQEAVGNLELSRMTELSSIERQILVEKHLISPDMLEQPEKRGVVLRDDEVISIMVNEEDHLRIQCLLPGLQLKECWDLANTVDDGLEQIIDYAFAKEQGYLTSCPTNIGTGLRASVMLHLPALVMTRQINAVLTTLSKLGLTVRGLYGEGTQATGNLFQVSNQVTLGLTEEEIIDNLITVALQLVTQERAARRALHKEQLHQIEDKVWRAYGLLKYARTMTSNETMTLLSDMRLGVDLGVITGIPPGIIMELIILSRPAFLSKVKGADLNPYQRDIFRATLIRERLNSLSNE

mcsB

Protein-arginine kinase

356 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.079 kDa

MSLDRIMNEAISPWMKGDGPDSDIVLSTRIRLARNLKNYHFPIMQTAEEANQITELFQQKLVNKTMRDFGSFELLKMNELTPLQRRVLVEKHLISPNLAETEFGACILSESEHISVMLNEEDHVRIQCLFPGLQLSEALQSANKIDNVFEEVVEYAFDEELGYVTSCPTNVGTGLRASVMIHLPALVLTKRINRIIQAIQQLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLTSVIHQLIQQEKAARELIVKNSSIELEDKVYRSYGILAHSRLIQSAEAATCLSDVRLGIDLGYIKDVSRNILTELMVLTQPGILQQYAGGQLGPEERDYRRAALIRERLRIEENEA

mcsB

Protein-arginine kinase

356 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.171 kDa

MSLQRFISEAISPWMKKDGPDSDIVLSSRIRLARNLQSFRFPLLATIEESKQLVEHVKHHLAESSYHTNRFELLCMDDMKPNVKRVLVEKHLISPHLAEESKHGAVMLSEDESISIMINEEDHLRIQCLFPGFQLSEALVLASGIDDWIEGKVDYAFDEKRGYLTSCPTNVGTGLRASVMMHLPALVMTQQINRILPAINQLGLVVRGIYGEGSEALGNLFQISNQMTLGKSEEDIVEDLRGVVMQLIQQERAARKRLLESSRLQLEDRVYRSYGILAHSRIIESKEATQKLSDVRLGIDLGLLKGVSGNILNELMILTQPGFLQQYAGTVLTADQRDERRAALIRARLKLEDESN

mcsB

Protein-arginine kinase

356 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

40.491 kDa

MLPNQILTDITTVKHSFKAETFRPISTLSLSRNLSVSKFVPCLSKENKRDVLETIAKEFSNIEGEEFFVLPLKDLPIWQRECLLEHYLCPYDLSGSLEGEALIVNRAGTLLAGINLRDHLVLHGIDFVWQPEMLLQKLIDLDIRLQQSLSFAFSPDFGFLTTDPLRCGTALVARAFIHVPALRYRNKLSELLVPHQREFACSSLLPLSQESLGDILCLSNICSLGVSEEQILSSLRLVVSKILSAETEARNLLLKENSTEIKNRILRSIGMLTHSCYLDLQEALDATSWIQLGMSMQWIEDSEKHPLWSPMFWDLRRGHLALYNQDPANKTIEKEIIAQIRAQTTKPQAERLILRV

mcsB

Protein-arginine kinase

356 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

40.244 kDa

MLPNHILTAIATIKHSLRTETPRPICTLSLSRNLSVSKFVPCLSKENKRDVLETIAKQFSAIEGEEFFVLPLKDLPIWQRECLLEHYLFPYHLGSYLEGEALIVNQAGTLLAGINLRDHLVIHGVDFVWQPEVLLQKLIDLDIRLQQSLSFAFSSDFGFLTADPLRCGTALIARAFVHVPALKYGDALSELLVPYQREFASSSLLPLSQESLGDILCLSNICSLGLSEEQILSSLRLVVSKILSAEREARNQLVKENPTEIKNRILRSVGMLTHSCCLDLQEALDATSWIQLGMSMQWIEDSEKHPLWNPLFWDLRRGHLALYNQDTANRSIEKEVIAQIRAKATKPQAERLIIRI

mcsB

Protein-arginine kinase

356 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.933 kDa

MTLRETVNNAHSHWMDADGPESEIIISSRVRVARNLAGIPFPHLLNKENSEKVIHAVRLAISNKEASELLGGLELSSLGELSPLERQILVDKHLISPDLLNDFQRKAVVLREDEVVSIMVNEEDHLRIQCILPGLQLKEAWDVVNRVDDGLEKTLDYAFSEKVGYLTSCPTNVGTGMRASVMIHLPGLKLAKQLAGVLNAINKLGLTVRGLYGEGTEALGDLFQISNQITLGQSEEEIINNLISIARQILAQEQAARRNLYKDRREVIEDRVFRAFGALKYARILSSEEAMRLFSDLRLGVEMKIISGIPVRLLNELMVKIRPAFITKMAGRELTPYQRDIFRAGLIRREFANLPV

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.035 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.035 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.035 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.035 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

39.99 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEEAKLIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

39.746 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKQYQFSTMQNEEEAKQIHELFKKKFINKAVGSFGEFGLLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDVRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLSIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.035 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

39.869 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKQYQFSTMQNEEEAQKVQELFKKKFINKAVEPFGKFGLLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFPGLQLSKALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVMQQIIQQEKLARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAATCLSDVRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.032 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEEAKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSENEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.032 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEEAKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSENEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

39.869 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKQYQFSTMQNEEEAQKVQELFKKKFINKAVEPFGKFGLLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFPGLQLSKALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVMQQIIQQEKLARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAATCLSDVRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.035 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.005 kDa

MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEEAKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEKN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.043 kDa

MSLDRIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEEAKQIHELFKKKFIKKPVEPFGEFELLKMNELNPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISIMLNEEDHVRIQCLFSGLQLSEALQSANQIDNWIEEQVEYAFDESLGYITSCPTNVGTGLRASVMIHLPGLVLTKRINRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADLKSVIQQIIHQEKTARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAATCLSDVRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEQN

mcsB

Protein-arginine kinase

354 amino acids

Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.

Belongs to the ATP:guanido phosphotransferase family.

40.454 kDa

MTLDKFIDQAISPWMREEGPDKDIVMSSRIRLARNFANQTYPILAKEEKLVEIQEFIRDEYANKSFQTYKDLQYVPLTDLSPVEKSVLVEKHLISPHLIKHSDFAATLISENEQVSIMVNEEDHLRIQVYYPGLQLKTALEQSFALDDWLEEKVDYAFDETKGYLTSCPTNVGTGMRASVMMHLPALVLTKQINRLIPAISQFGLVVRGIYGEGSEALGNIFQVSNQITLGKSEQDIVDDLESVVHQLIEHERMARNHILERTGKKLEDRIFRSYGTLAYSRIIDSKEASKCISDVRLGIDLGLIDNTSGNILNELMVLTQPGFLQHYANRSLRPDERDVLRASVIRERLKLEE

mcsB

Protein-arginine kinase

353 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.405 kDa

MGWNELVSRAESRWMEGTGPHADIVLSSRIRLARNLDDLPFPQRMSEPDTERLLQAAEAGVREINLVGFPSRVELYRLADTTPLDRQILVEKHLISPQQSKEVMAKAVAISEDEAISIMVNEEDHLRIQVLASGLQLQEAWRVASQVDDALEQRLQFAFDEQLGYLTACPTNVGTGLRASVMMHLPALVLTQQAGRLFHNLSQLGLVVRGLYGEGTEAAGQIFQISNQTSLGKAEEEIIANLEAIARTVIDTEEQARRHLYGEMRLQIEDRVSRAYGILTTARMISSEEAMRLLSDVRLGVALGVVPKIDYRILNELLVAMQPACLQRQAGRELNPLERDVRRAALIRARLSA

mcsB

Protein-arginine kinase

350 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.809 kDa

MSLNLERNSKWMEGSGPQADIVISSRIRLARNLKGLPFPNLMNSDQQARVVSQVSRAIQAPMVFQAVGELKLQPLRELAPVERQILVEKHLISPDLAAGGGEKAVVLRDDEAVSIMVNEEDHLRLQCLLPAMMLHEAWRLADAADDALENELDFAFDQERGYLTACPTNVGTGLRASTMLHLPALVLTRQAGPVLSALTKVGVAVRGLYGEGTEAQGNIFQVSNQITLGRSEEEIINNLSAVTVRLADQEREARELLRRQSRWQLEDRVGRAYGVLTNARILSSQEALQLLSDVRLGAEMKIIRGLDQRLLNQLMVRIQPAFLQFSAGKEMTPMERDVHRAAMVRELLAG

mcsB

Protein-arginine kinase

349 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.109 kDa

MSLKDLINKNLSHWVAGQGPERDIVLSSRIRLARNLDTIPYPNRADKDSKEEVTKRVLDATSKQGKIKLHYIKMDDLPEVEREVLVEKHLISPAHAKAGEGKGVLLNDNETISIMINEEDHLRLQVLIPGLQLEGAWETASELDDLLEEKLDFAFSQKWGYLSACPTNVGTGLRASVMVHLPALNLTNNINKMLGAISKVGLTVRGIYGEGSEYVGNLYQISNQVTLGHTEKEIIANLKSVTSQIIEQERQARNLLLKEKEIEVRDRVNRSFGILSHAYQISSEEALRMLSNVKLGIDMGIITDVDTGVLSELMVLIRPAHLQKLEGKELTPTERDIKRAELIKTRLNM

mcsB

Protein-arginine kinase

347 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.508 kDa

METFLTHPLGPKMKERAKLDDLVVSTRIRLARNVKDTVFSPVLSKEGERQLCDRLEGRLRGLKGFEYLHMRDYDEVTRQALMEKHLISPAVAANEESAVFLSEDETISVLINEEDHLRIQTLLPGYQVKEAFELANQVDALCAESLSYAFDEQLGYLTTCPSNIGTGLRASVMLHLPGLTLTGRISPILRELRKLGYTIRGRYGEGSDAAGRLFQLSNQRTLGSHESQLLADFMEVTEQVIQAERHAREELIAHRQEELEDRFYRSYGILRYAKLLSSTEAIERLSDLHLASDLGILSDWSPPKFHELIVRLQSGFLQKHFGKTLSTQERDRERATLVRRTLDQGLV

mcsB

Protein-arginine kinase

345 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.135 kDa

MNNWVTTYENHNYGLVISSRIRLARNLAKIPFSHKLNIEESKKVIKNVENAFYTFSNTEEKFKSNYLWDKNDNEKNIYLEKHLISKNLIDNSSKAAFILDDKETISIMINEEDHVRIQCITGGLNLEEVYDVSEKIDDLLEENLEYAFDEKLGYLTACPTNVGTGLRASVMLHLPSLSLNNQINGFLNALAQVGMTIRGLYGEGSKAIGNIYQISNQVTLGRSEEEILSNLKALVLQIINQEIISRENLMKKYKYELEDKIYRALGVLKSAVLLNSSECLKLLSDVRLGVEMGIIKDVNGITLNKLLVESQPATIQKIYGESLSNKDRDFNRAKFVREKLAVNTA

mcsB

Protein-arginine kinase

345 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.135 kDa

MNNWVTTYENHNYGLVISSRIRLARNLAKIPFSHKLNIEESKKVIKNVENAFYTFSNTEEKFKSNYLWDKNDNEKNIYLEKHLISKNLIDNSSKAAFILDDKETISIMINEEDHVRIQCITGGLNLEEVYDVSEKIDDLLEENLEYAFDEKLGYLTACPTNVGTGLRASVMLHLPSLSLNNQINGFLNALAQVGMTIRGLYGEGSKAIGNIYQISNQVTLGRSEEEILSNLKALVLQIINQEIISRENLMKKYKYELEDKIYRALGVLKSAVLLNSSECLKLLSDVRLGVEMGIIKDVNGITLNKLLVESQPATIQKIYGESLSNKDRDFNRAKFVREKLAVNTA

mcsB

Protein-arginine kinase

344 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.798 kDa

MENWINVNNASEDIVLSSRIRLARNLKGIPFPNKLTVDSAKDVVEKVENAIFTIPDLKDNLKSNHLWENDNETNKMYLEKHLISRGLIKHAKGSAFLIDNDETISIMINEEDHLRLQTITSGLNFKEVFKSINELDDLLEENLEYAFHEKLGYITACPTNLGTGLRASAMVHLPALTANKDIVKILNGITQLGMTIRGLYGEGSKAYGNLYQISNQITLGRAEEQIITSLEGIVKQIIQQERLARERMKTKYKYEVEDKIFRSLGVLKSARILTAREVLNLLSNVRLGVEEGIISNIDKSILNNLLINTQSASIKKSSQKKLTDIEEKIERAKIVKEGLKGIEL

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.809 kDa

MKNWLNSDLKDNDIVITTRIRLARNIKGIPFPDKLSDDEGRDVVKKIKDTLIVSNDGKENFTCIDLWKNDNNCNAEYLEKHLISKKLIENYNRSAFILNKDETISVMVNEEDHLRLQAITAGLNLEEAYECIDRIDDKIEENLDYAFDEKIGYLTACPTNIGTGMRASVMIHLPALSMNNEMPRILNALSQIGITIRGLWGEGSKAIGSLYQISNQITLGMSENDIISNLKTVVEQIINQENLSREQLMKKYKYELEDKIARSLGILKNSVILDSNECLNLISNVRMGVEIGIINDISKKSLNNLLVNTQRATLQEIYNKELSKKEENIKRALYVRENLR

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

39.145 kDa

MNNWIHTSLDNSDIVLSSRIRLARNLSNFTYPHKISIEEGRKIVETIEKVLQNEESKYKVYRLWEMDPLDRVTYLEKYLISSKLILNNEKGAFITNEDETVSLMINEEDHIRLQCITNGFNLEEAYKCAEDLDDLIEENLDYAFDENLGYMTACPTNLGTGLRASVMIHLPTLTMNREINKIFSGLTQIGMTIRGIYGEGSKVVGNLFQVSNQLTLGLSEEEVINNLKAVVYQIINQEKLAREKIMKMHKYRIEDKVYRALGILNSAVLLDSEECLKLLSYVRLGVEMDIIKDVSKKVLNELTISIQPAMIQRIFNSKLTEEARQLKRAELVKRKLKNSI

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.8 kDa

MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYDQKEEVVDNIAEVFDDNFTLIKMNQISKLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIMLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLTYAFDKQFGYLTSCVTNIGTGMRASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASSIFQVSNQVTLGKTETEIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMQEASDAISDIRLGVELGFFEHISRQKMNELVLFSQPAFLRKEAGRDMDELEEKVIRAKVIREILGDK

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.841 kDa

MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPVYEQKEEIVDNIAEVFDDNFTLIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIMLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGMRASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTETEIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMKEASDAISDIRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.841 kDa

MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPVYEQKEEIVDNIAEVFDDNFTLIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIMLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGMRASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTETEIVEDLTQVMEQIIMQERVARTTIKQKFHIALEDRVFRSYGLLMNCRIISMKEASDAISDIRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.746 kDa

MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYEQKEEIVDKIAGAFDDNFTLIKMNQISHLEKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIMLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKQFGYLTSCVTNIGTGMRASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSLPASSIFQVSNQVTLGKTETEIVEDLTQVMEQIIMQERIARTTLKQKFHIALEDRVFRSYGLLTNCRIISMREASDAISDVRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.855 kDa

MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYEQKEEIVDNIAEVFDDNFILIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIMLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGMRASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTEAEIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMKEAADAISDIRFGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK

mcsB

Protein-arginine kinase

340 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.756 kDa

MNVFEPRLSSWLVNSGDDDDVVLSSRIRLARNLKDERFPIYEQKEAIVDNIAEVFDENFTLFKMNQISVLQKALLVEKHLISPYMMKKSKYGAVLLNEEENVSIMLNEEDHLRIQCMTPGLRLFDALEAALQIDGHVEEKLTYAFDKQFGYLTSCVTNIGTGLRASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASSIFQVSNQVTLGKTETEIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMQEAADAISDIRLGVELGFFEHISRQKMNELVLFSQPAFLRKEAGRDMDELEEKVIRAKVIREILGDK

mcsB

Protein-arginine kinase

339 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.992 kDa

MKNWINEECNKEDIVINSNISLSRNLKEKPFSNKLNEIEARENVGFIYQIVKSELKDESCIYQLWNEDKELINSYLDKQLISKELIKNKDKTAFVLNSEETLSIMINEDDHLKLRCITAGFDLETAFDNITKLDDKIEKRVHYAFDENLGYLTTSPTNLGTGMRASVNIHLPALNFNDEISNFSKGLTQIGMDMKGLYEEGNKAYGNMYKISNQVTLGLTEEEIIDNLKGAVLNVISEEKKFREVLLTKCKYDIEDKVFRAYGILTSAILLSEKECTELLSSVRFGVELSLLDISKNKLNKLLVYTRDSSLQNYLKRKLSNKELNYERAKFVRAILAQN

mcsB

Protein-arginine kinase

337 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.009 kDa

MLQYDKDVVLSSRIRLARNVKDIPFPTVMTEEQGKKVIELARKAILGSNTILSTQFTEYEMKKLTPLDRQALVEKHLISPDLSQNIKTGYALIKDDNTVSIMVNEEDHLRIQCILPGLKLDESWDMADKIDDLIEETIDYAYDEKIGYLTSCPTNVGTGIRASVMVHLPALTITGQISNILNSVSKIGMAVRGIYGEGTQALGDIYQISNQVTLGQSEKEIIENIEGVAKQIISSERRAREELYKKQRVQIEDRVGRAFGILSHAKVMSTKEYMTLMSDVRLGIVLGILSVDLDKLDRLTTQIQPANLQKIYGMQLNPYERDVKRAEYVSTQLNKKE

mcsB

Protein-arginine kinase

337 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.686 kDa

MVQWISPLDNSIVIASKVKILRNIKGIKFTKLLNEEEFNDLLSMVLGRLKEIDILDKCYVVKLKDGEEKIIDYYKENFGLIKYFENKDNLIFIMNKNGEFNILLNEEEHIGIECTNSGLSLREVYSKVDNLDDLIEEKIHYSFDSELGYLTSNIKNLGTALRAKVFIHLPLLSSNNLIRIIKNALKEEGITLKSIYNSGNKDVGNIYEVSNIKTLGMSEKDILDSLISITNKLILREKNQRDNLSKDEYIELKDDILRSLGVLRNTYSIDRDEALKYLSYVRLGVELGIIEDLSLKSVNSAMIEIQPDMINNSSIKKRDIQSLKIERAKIIRNALNT

mcsB

Protein-arginine kinase

337 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.766 kDa

MVQWISPLDNSIVIASKVKILRNIKGIKFTKLLNEEEFNDLLSMVLGRLKEIDILDKCYVVKLKDGEEKIIDYYKENFGLIKYFENKDNLIFIMNKNGEFNILLNEEEHIGIECTNSGLSLREVYSKVDKLDDLIEEKIHYSFDSELGYLTSNIKNLGTALRTKVFIHLPLLSSNNLIRIIKNALKEEGITLKSIYNSGNKDVGNIYEVSNIKTLGMSEKDILDSLISITNKLILREKNQRDNLSKDEYIELKDDILRALGVLRNTYSIDRDEALKYLSYVRLGVELGIIEDLTLKPVNSAMIEIQPDMINNSSIKRRDIQSLKIERAKIIRNALNT

mcsB

Protein-arginine kinase

337 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.665 kDa

MVQWISPLDNSIVIASKVKILRNIKGIKFTKILNEDEFNDLLSMVLGCFKEIDILDKCYVVKLKDGEEKIIDYYKENFGLIKYFENKDNLIFLMNKNGEFNILLNEEEHIGIECTNSGLSLREVYSKIDNLDDLIEEKIHYSFDSELGYLTSNIKNLGTALRAKVFIHLPLLSSNNLIKIIKNALKEEGITLRSIYNSGNKDVGNIYEVSNIKTLGMSEKDILDSLISITNKLILREKNQRDNLSKDEYIKLKDDILRALGILRNTYSIDRDEALKYLSYVRLGVELGIIEDLTLKSVNSAMIEIQPDMINNSSIKKIDIQSLKIERAKIIRNTLNT

mcsB

Protein-arginine kinase

336 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.756 kDa

MSKNDISAYMSEWMRDREESPIVMSSRIRLARNLENHVHPLMFLSEQDGFRIINEVQDALPDLAVQRLDAMDQQSKYKLVAKHLISPELIRQPASAVLLNEDESLSIMVNEEDHLRIQAMGNDLSLSSLYEKASEIDDKLDSELDVSFDETLGYLTTCPTNIGTGMRASVMLHLPGLTIMKRMNRIAQTINRFGFTIRGIYGEGSHVYGHIYQISNQLTLGKTEEDIIESLSEVVQQIINEEMQIRERLNRHNYTETLDRVYRSLGILKYSRLISMEEASLRLSEVKLGIDLEYIELEDFKFNELMVAIQSPFLLDDEDDRTVNEKRADILREHIN

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.459 kDa

MMSNIHTNISEWMKMSEETPVIISSRIRLARNLENHVHPLMFPSEQEGYRVINEVQDALSNLTLNRLDTMDQQSKMKLVAKHLVSPELVKQPASAVMLNDDESVSVMINEEDHIRIQALGTDLSLKDLYQRASKIDDELDKALDISYDEHLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMNRIAQTINRFGFTIRGIYGEGSQVYGHIYQVSNQLTLGKTEEDIIDNLTEVVNQIINEEKQIRERLDKHNSVETLDRVYRSLGVLQNSRIISMEEASYRLSEVKLGIDLNYILLENFKFNELMVAIQSPFLIDDDDNRTVNEKRADLLREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.459 kDa

MMSNIHTNISEWMKMSEETPVIISSRIRLARNLENHVHPLMFPSEQEGYRVINEVQDALSNLTLNRLDTMDQQSKMKLVAKHLVSPELVKQPASAVMLNDDESVSVMINEEDHIRIQALGTDLSLKDLYQRASKIDDELDKALDISYDEHLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMNRIAQTINRFGFTIRGIYGEGSQVYGHIYQVSNQLTLGKTEEDIIDNLTEVVNQIINEEKQIRERLDKHNSVETLDRVYRSLGVLQNSRIISMEEASYRLSEVKLGIDLNYILLENFKFNELMVAIQSPFLIDDDDNRTVNEKRADLLREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.543 kDa

MSDMNAHISEWMKETEESPIVMSSRIRLARNLENHVHPLMFPSEQDGFRVINEVQDVLPDLDLMRLDTMDQQNKMKLVAKHLISPELIKQPASAVLLNKDESISIMINEEDHIRIQAMGTDLSLQDLYNIASEIDDTLDQSLDISYDEHLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMNRIAQTINRFGFTIRGIYGEGSQVYGHIYQISNQLTLGKTEDEIIDNLTEVVQQIINEEMQIRERLTQYNELETLDRIYRSLGILQNSRIISMEEASYRLSEVKLGIDLGYLTLSDFKFNELMVSIQSAFIYNDEDETISVNEKRANILREYTQ

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.596 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHDEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins (By similarity). Is required for stress tolerance and virulence in S.aureus. Acts as a modulator of the repressor activity of CtsR upon heavy metal and oxidative stress caused by these metal ions (PubMed:22902728).

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.61 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.596 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHDEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK

mcsB

Protein-arginine kinase

335 amino acids

Catalyzes the specific phosphorylation of arginine residues in proteins.

Belongs to the ATP:guanido phosphotransferase family.

38.596 kDa

MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIHDEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK