About Products Protein Database Contact

Protein expression services for mcsB | Protein-arginine kinase

Description
Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein arginine phosphorylation has a physiologically important role and is involved in the regulation of many critical cellular processes, such as protein homeostasis, motility, competence, and stringent and stress responses, by regulating gene expression and protein activity.
Family
Belongs to the ATP:guanido phosphotransferase family.
Species
Bacillus clausii (strain KSM-K16)
Length
358 amino acids
Sequence
MSLDRFLKNAISPWMKKDGSDADIVLSSRIRLARNMSAFTFPMLSSKEEAYAVAKHVKDALGGTQGEALGKAEMLAMEDMRTNDKRMLVEKHLISPHLAEQSKYGMVLLSGDESLSIMINEEDHIRIQSLSAGFELENCLQAANAVDDWVESHLTYAYDSQYGYLTSCPTNVGTGMRASVMIHLPALAMTRQLQRILPAINQLGLVVRGIYGEGSEALGNLFQISNQITLGKTEQDIVDDLQGVVKQLIRQERVARDSLLQHSKLELKDRVFRSYGILANSYIIDSKEATRRLSDVRLGIDLGFIENTAGKILDELMILTQPGFLQQYAKTVLTPEQRDERRAALIRERLKLEHETAD
Mass
40.1 kDa
Simulated SDS-PAGE
Western blot of mcsB recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mcsB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here