mcrG

Methyl-coenzyme M reductase subunit gamma

261 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.

Belongs to the methyl-coenzyme M reductase gamma subunit family.

30.132 kDa

MAYKPQFYPSATKVAENRRNHINPAFELEKLREIPDEDVVKIMGHRQPSEDYKTVHPPLEEMDLAEDYVRDLVGPINGAKEGHRIRYIQFADSMYFAPSQPYDRSRLYMSRFRGVDCGTLSGRQVVELRESNLEDISKNYLVDTELFDPATTGMRGATVHGHSLRLDENGVMFDALQRYEFDEATGHILYVKDQVGRPWDEPVDVGEPVPQEKLKEITTIYRKDGVAMRDDMEVVEVVKRIHRARTLGGYCPLNEIFDTYL

mcrG

Methyl-coenzyme M reductase I subunit gamma

260 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.

Belongs to the methyl-coenzyme M reductase gamma subunit family.

30.174 kDa

MAYKPQFYPGQTKIAQNRRDHMNPDVQLEKLRDIPDDDVVKIMGHRQPGEDYKTVHPPLEEMDLPEDYVRDLVEPLNGAKEGHRIRYIQFTDSMYFAPAQPYDRARTYMWRFRGVDTGTLSGRQVIEMRESDLEALSKNFLIDTAFFDPARIGIRGATVHGHSLRLDENGLMFDALQRYVYDEKTGHVLYVKDQVGRPLDEPVDVGEPLPEEKLKEITTIYRIDGVPMREDEELLTVVKRIHRARTLGGFLPVEDVFEKL

mcrG

Methyl-coenzyme M reductase subunit gamma

260 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.

Belongs to the methyl-coenzyme M reductase gamma subunit family.

29.782 kDa

MAYKPQFYPGATKVAENRRNHLNPNYELEKLREIPDEDVVKIMGHRQPGEDYKTVHPPLEEMDMPADYVRDLVEPLNGAKEGHRVRYIQFADSMYFAPAQPYDRSRLYMIRLRGVDAGTLSGRQVVECRESDLEEFSKNLLMDTELFDPATSGVRGATVHGHSLRLDENGMMFDALQRCVFDEKTGHVMYVKDQVGKPLDQPVDVGEPMPEAKLREITTIYRKDGIAMRTDPEVIEVVKRIHRARTLGGYIPTNEIFKGL

mcrG

Methyl-coenzyme M reductase subunit gamma

249 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.

Belongs to the methyl-coenzyme M reductase gamma subunit family.

28.856 kDa

MAQFYPGSTKIAENRRKFMNPDAELEKLREISDEDVVRILGHRAPGEEYPSVHPPLEELDEPEDPIKDIVEPTEGAKAGDRVRYVQFTDSVYFAPAQPYIRSRAYLWRYRGADAGTLSGRQIIEARERDVEKIAKELIETEFFDPARTGIRGKSVHGHSLRLDENGMMFDMLRRQVYDEETGRVKMVKNQIGDEFDEPIDLGEPLDEETLKEKTTIYRIDNIPYREDKDLLEIVQRIHQLRSEAGFSPE

mcrG

Methyl-coenzyme M reductase I subunit gamma

249 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.

Belongs to the methyl-coenzyme M reductase gamma subunit family.

28.717 kDa

MAQYYPGTSKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREMVEPIDGAKAGDRVRYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGRQIIETRERDLEKISKELLETEFFDPARSGVRGKSVHGHSLRLDEDGMMFDMLRRQIYNKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMNKTTIYRVDGEAYRDDTDAVEIMQRIHVLRSQGGYNPE

mcrG

Methyl-coenzyme M reductase I subunit gamma

249 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis (PubMed:2269306, PubMed:3350018). Neither N-6-mercaptohexanoylthreonine phosphate (H-S-HxoTP) nor N-8-mercaptooctanoylthreonine phosphate (H-SOcoTP) nor any other thiol compound such as CoA or CoM can substitute for CoB as the electron donor (PubMed:3350018).

Belongs to the methyl-coenzyme M reductase gamma subunit family.

28.758 kDa

MAQYYPGTTKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREMVEPIDGAKAGDRVRYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGRQIIETRERDLEKISKELLETEFFDPARSGVRGKSVHGHSLRLDEDGMMFDMLRRQIYNKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMEKTTIYRVDGEAYRDDVEAVEIMQRIHVLRSQGGFNLE

mcrG

Methyl-coenzyme M reductase subunit gamma

248 amino acids

Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.

Belongs to the methyl-coenzyme M reductase gamma subunit family.

27.811 kDa

MAYERQYYPGATSVAANRRKHMSGKLEKLREISDEDLTAVLGHRAPGSDYPSTHPPLAEMGEPACSTRENVAATPGAAAGDRVRYIQFADSMYNAPATPYFRSYFAAINFRGVDPGTLSGRQIVEARERDMEQCAKVQMETEITDHALAGVRGATVHGHSVRLQEDGVMFDMLDRRRLENGTIIMDKDQVAIPLDRKVDLGKPMSSEEAAKRTTIYRVDNVAFRDDAEVVEWVHRIFDQRTKFGFQPK