Protein expression services for mcrG | Methyl-coenzyme M reductase subunit gamma
Description
Component of the methyl-coenzyme M reductase (MCR) I that catalyzes the reductive cleavage of methyl-coenzyme M (CoM-S-CH3 or 2-(methylthio)ethanesulfonate) using coenzyme B (CoB or 7-mercaptoheptanoylthreonine phosphate) as reductant which results in the production of methane and the mixed heterodisulfide of CoB and CoM (CoM-S-S-CoB). This is the final step in methanogenesis.
Family
Belongs to the methyl-coenzyme M reductase gamma subunit family.
Species
Methanococcus vannielii
Length
260 amino acids
Sequence
MAYKPQFYPGATKVAENRRNHLNPNYELEKLREIPDEDVVKIMGHRQPGEDYKTVHPPLEEMDMPADYVRDLVEPLNGAKEGHRVRYIQFADSMYFAPAQPYDRSRLYMIRLRGVDAGTLSGRQVVECRESDLEEFSKNLLMDTELFDPATSGVRGATVHGHSLRLDENGMMFDALQRCVFDEKTGHVMYVKDQVGKPLDQPVDVGEPMPEAKLREITTIYRKDGIAMRTDPEVIEVVKRIHRARTLGGYIPTNEIFKGL
Mass
29.8 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mcrG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here