mcfG

Mitochondrial substrate carrier family protein G

300 amino acids

Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

32.112 kDa

MASNNKDSQLMIALKDIVAGSIGGVGQVFTGHPLDTIKVRLQTQSVGNPIYSGTMDCLKKTISQEGFAGLYKGVASPLVGLSIMNSVMFLAYGQSKTLIQKLSDNPNEALDLKGLTAAGALAGIAIGFVDAPVDLFKSQMQVQQGDKNQYKSTADCAKQIWKVGGVRGVFQGLGATLVRDIPANACYFGAYELCRDFLASKDNISVNQLSSLQIMAAGGAGGVSYWTLTYPADVVKSTMQTDAIVKSQRKYKNMIDCASKIYKQQGIAGFYKGFTPCFIRSVPANAACFVLYEKARQIMS