Protein expression services for mcfG | Mitochondrial substrate carrier family protein G
Description
Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway (By similarity).
Family
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Species
Dictyostelium discoideum
Length
300 amino acids
Sequence
MASNNKDSQLMIALKDIVAGSIGGVGQVFTGHPLDTIKVRLQTQSVGNPIYSGTMDCLKKTISQEGFAGLYKGVASPLVGLSIMNSVMFLAYGQSKTLIQKLSDNPNEALDLKGLTAAGALAGIAIGFVDAPVDLFKSQMQVQQGDKNQYKSTADCAKQIWKVGGVRGVFQGLGATLVRDIPANACYFGAYELCRDFLASKDNISVNQLSSLQIMAAGGAGGVSYWTLTYPADVVKSTMQTDAIVKSQRKYKNMIDCASKIYKQQGIAGFYKGFTPCFIRSVPANAACFVLYEKARQIMS
Mass
32.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mcfG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here