map

Protein map

689 amino acids

Both native and recombinant protein bound to labeled vitronectin, fibrinogen, recombinant osteopontin and fibronectin. It was also shown to be able to bind to a 15-amino acid synthetic peptide of vitronectin. Map could affect the severity of arthritis and osteomyelitis in mice through a T-cell-mediated mechanism and could play a role in abscess formation through a T-cell-independent mechanisms. It could potentiate the survival of the bacterium by modulating host immunity (By similarity).

76.848 kDa

MKFKSLITTTLALGVLASTGANFNTNEASAAAKQIDKSSSSLHHGYSKIQIPYTITVNGTSQNILSSLTFNKNQQISYKDIENKVKSVLYFNRGISDIDLRLSKQAKYTVHFKNGTKRVVDLKAGIHTADLINTSDIKAISVNVDTKKQVKDKEAKANVQVPYTITVNGTSQNILSNLTFKKNQQISYKDLENNVKSVLKSNRGITDVDLRLSKQAKFTVNFKNGTKKVIDLKAGIYTANLINTGDIKNININVETKKQAKDKEAKANNQVPYSINLNGTTTNIQSNLAFSNKPWTNYKNLTAKVKSVLKSDRGVSERDLKHAKKAYYTVYFKNGGKRVIHLNSNIYTANLVHAKDIKKIEVTVKTGSKANAERYVPYTIAVNGTSTPNLSDLKFKGDSRVSYSDITKKVKSVLKYDRGIGERELKYAKKATYTVHFKNGTKKVINLNSKISQLNLLFVKDIKKIDVDVKTGSKAKADSYVPYTIAVNGTSTPIASKLKLSNKQLIGYQDLNKKVKSVLKHDRGINDIELKFAKQAKYTVHFKNGKTQVVDLKSDIFTRNLFSVKDIKKIDIDVKQHTKSNKALNKVSNIATKVKFPVTINGFSNVVSNEFAFLHPHKITTNDLNAKLRLALASDQGITKHDIGLSERTVYKVYFKDGSSKFVDLKAAKQDSKVFKATDIKKVDIEIKF

map

Protein map

689 amino acids

Both native and recombinant protein bound to labeled vitronectin, fibrinogen, recombinant osteopontin and fibronectin. It was also shown to be able to bind to a 15-amino acid synthetic peptide of vitronectin. Map could affect the severity of arthritis and osteomyelitis in mice through a T-cell-mediated mechanism and could play a role in abscess formation through a T-cell-independent mechanisms. It could potentiate the survival of the bacterium by modulating host immunity.

77.049 kDa

MKFKSLITTTLALGVIASTGANLDTNEASAAAKQIDKSSSSLHHGYSKIQIPYTITVNGTSQNILSSLTFNKNQQISYKDIENKVKSVLYFNRGISDIDLRLSKQAKYTVHFKNGTKRVVDLKAGIHTADLINTSDIKAISVNVDTKKQVKDKEAKANVQVPYTITVNGTSQNILSNLTFKKNQQISYKDLENNVKSVLKSNRGITDVDLRLSKQAKFTVNFKNGTKKVIDLKAGIYTANLINTGGIKNININVETKKQAKDKEAKVNNQVPYSINLNGTTTNIQSNLAFSNKPWTNYKNLTTKVKSVLKSDRGVSERDLKHAKKAYYTVYFKNGGKRVIHLNSNIYTANLVHAKDVKRIEVTVKTVSKVKAERYVPYTIAVNGASNPTLSDLKFTGDSRVSYSDIKKKVKSVLKHDRGIGERELKYAEKATYTVHFKNGTKKVINLNSNISQLNLLYVKDIKNIDIDVKTGAKAKVYSYVPYTIAVNGTTTPIASKLKLSNKQLIGYQDLNKKVKSVLKHDRGINDIELKFAKQAKYTIHFKNGKTQVVDLKSDIFTRNLFSVKDIKKIDINVKQQSKSNKALNKVTNKATKVKFPVTINGFSNLVSNEFAFLHPHKITTNDLNAKLRLALRSDQGITKHDIGLSERTVYKVYFKDGSSKLEDLKAAKQDSKVFKATDIKKVDIEIKF

map

Protein map

476 amino acids

53.377 kDa

MKFKSLITTTLALGVIASTGANFNTNEASAAAKPLDKSSSTLHHGHSNIQIPYTITVNGTSQNILSSLTFNKNQNISYKDIENKVKSVLYFNRGISDIDLRLSKQAEYTVHFKNGTKRVIDLKSGIYTADLINTSDIKAISVNVDTKKQPKDKAKANVQVPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTANLINSSDIKSININVDTKKHIENKAKRNYQVPYSINLNGTSTNILSNLSFSNKPWTNYKNLTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRIEITVKTGTKAKADRYVPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTVYFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKK

map

Protein map

476 amino acids

53.377 kDa

MKFKSLITTTLALGVIASTGANFNTNEASAAAKPLDKSSSTLHHGHSNIQIPYTITVNGTSQNILSSLTFNKNQNISYKDIENKVKSVLYFNRGISDIDLRLSKQAEYTVHFKNGTKRVIDLKSGIYTADLINTSDIKAISVNVDTKKQPKDKAKANVQVPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTANLINSSDIKSININVDTKKHIENKAKRNYQVPYSINLNGTSTNILSNLSFSNKPWTNYKNLTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRIEITVKTGTKAKADRYVPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTVYFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKK

map

Methionine aminopeptidase

301 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

33.252 kDa

MTEDELNKLLLAGKIAAKARDEVSLDVKASAKVLDICEEVESIIIENKAFPSFPCNISINSEAAHYSPTINDEKRIPEGAVVKLDLGAHIDGFISDTAITISLDSRYQRLLDASKTALEAAITNFKAGLSIGEIGRVIEKVIRAQGYKPIRNLGGHLIRRYELHAGVFIPNVYERGLGVIQSDSVYAIEPFATDGGGEVVEGKSITIYSLKNPNIKGLSSRENELIDFIYTRFNYLPFSERWLKEFSTNVDELRNNIKNLVKKGALRGYPILIEIKKGVVSQFEHTVIVKGDSIIVSTKSL

map

Methionine aminopeptidase

299 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

33.431 kDa

MIKMIESYLKAGKIVSKVRREAAGIIRDGLPIIELVNYVEDRIIEEGGRPAFPCNVSVNEVTAHYTSPPGDDSVIGDGDLVKLDLGAHVDGFIADTAITVPVGDVDDKCHQMMDAAREALENAISTIRAGVEVGEIGRVIEETIHSHGMNPVSNLTGHSMERWILHSGLSIPNINERNTHQLEEGDVLAIEPFATDGVGLVTDMPQTYIFRFLRERPLRLVHARRVLGKIREEYHALPFAQRWLEEYFDAKRLNASMRMLIQSRAIYPYHVLREKSGAMVAQWEHTVIVEEDGCTVITE

map

Methionine aminopeptidase

295 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

33.021 kDa

MDEREALIKAGEIARQVKKEVVDLIKPGAKLYDIAEFVERRIVELGGKPAFPCNLSINEIAAHYTPYKGDGTVLKEGDYLKLDIGVHVDGYIADTAVTFRVGMEEDELMEAAREALENAIATVRAGVMIRDVARAIEETIRGKGFNPIVNLSGHKVERYKLHAGVSVPNVYREADTYVLQEGDVFAIEPFATTGAGQVIEVPPALIFMYLRDRPVRMLQARRLLMHIKKNYKTLPFAYRWLQDFLPEGQLKLALAQLEKAGAIYAYPILREVRGGMVAQFEHTVIVEKEGAYITT

map

Methionine aminopeptidase

295 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

33.013 kDa

MDEREALIKAGEIARQVKKEVISLIKPGTKLYDIAEFVERRIIELGGKPAFPCNLSINEIAAHYTPYKGDETVLKEGDYLKVDIGVHVDGYIADTALTFRVGMEEDDLVTAAREALENAIKVIRAGIKINEIGKAIEETIRGYGFNPIVNLSGHKIERYKLHAGISIPNIYRPADSYVLKEGDVIAIEPFATTGAGQVIEVPPALIFMYLRDRPVRMAQARRVLMHIKREYNGLPFAYRWLQGFMPEGQLKLALAQLDRVGAIYSYPILREVRGGLVAQFEHTVIVEKEGAYITT

map

Methionine aminopeptidase

295 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

33.027 kDa

MDVDKLIEAGKIAKKVREEAVKLAKPGVSLLELAEKIEGRIIELGAKPAFPVNLSLNEIAAHYTPYKGDETTLKEGDYLKIDIGVHIDGYIADTAVTVRVGMEEDDLMEAAREALESAISVARAGVEIKELGRAIEDEIRKRGFNPIVNLSGHKIERYKLHAGISIPNIYRPHDNYKLREGDVFAIEPFATTGAGQVIEVPPTLIYMYVRDAPVRMVQARFLLAKIKREYKTLPFAYRWLQGEMPEGQLKLALRTLEKSGALYGYPVLREIRNGLVTQFEHTIIVEKDSVIVTTE

map

Methionine aminopeptidase

295 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

32.842 kDa

MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

map

Methionine aminopeptidase

295 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

32.795 kDa

MDVDKLIEAGKIAKKVREEAVKLAKPGVSLLELAEKIESRIVELGGKPAFPANLSLNEVAAHYTPYKGDQTVLKEGDYLKIDLGVHIDGYIADTAVTVRVGMDFDELMEAAKEALESAISVARAGVEVKELGKAIENEIRKRGFNPIVNLSGHKIERYKLHAGVSIPNIYRPHDNYVLQEGDVFAIEPFATTGAGQVIEVPPTLIYMYVRDAPVRMAQARFLLAKIKREYKTLPFAYRWLQGEMPEGQLKLALRSLERSGALYGYPVLREIRGGMVTQFEHTIIVEKDSVTVTTE

map

Methionine aminopeptidase

294 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

32.95 kDa

MEIEGYEKIIEAGKIASKVREEAVKLIXPGVKLLEVAEFVENRIRELGGEPAFPCNISINEIAAHYTPKLNDNLEFKDDDVVKLDLGAHVDGYIADTAITVDLSNSYKDLVKASEDALYTVIKEINPPMNIGEMGKIIQEVIESYGYKPISNLSGHVMHRYELHTGISIPNVYERTNQYIDVGDLVAIEPFATDGFGMVKDGNLGNIYKFLAKRPIRLPQARKLLDVISKNYPYLPFAERWVLKNESERLALNSLIRASCIYGYPILKERENGIVGQAEHTILITENGVEITTK

map

Methionine aminopeptidase

291 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

32.646 kDa

MKRNDPCWCGSQKKWKHCHYPTKPERPSDNLRQLYASRYDIIIKTPDQIEKIRKACQVTARILDALCKAAKEGVTTNELDQLSCNLHKQYNAIPAPLNYGQPPFPKTICTSLNEVICHGIPNDTPLQNGDIMNIDVSCIVDGFYGDCSRMVMIGEVPEIKKKVCEASLEALNAAIAILEPNLPLYEIGEVIENCAARYGFSVVDQFVGHGVGVRFHENPYVAHHRNSCKIPLAPGMTFTIEPMINVGKKEGFIDPTNHWEARTCDHQPSAQWEHTVLITDSGYEILTLLDN

map

Methionine aminopeptidase

291 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

32.596 kDa

MKRNDPCWCGSGRKWKQCHYPQPPKMSPEALKQHYASQYNILLKTPEQKAKIYNACQITARILDELCKASQKGVTTNELDELSQELHKKYDAIAAPFHYGSPPFPKTICTSLNEVICHGIPNDIPLKDGDIMNIDVSCIVDGYYGDCSRMVMIGEVPEIKKKICQAALECLNDSIAILKPGIPLCEIGEAIEARADTYGFSVVDQFVGHGVGIEFHENPYVPHYRNRSMIPLAPGMIFTIEPMINVGKKEGVVDPKNQWEARTCDNQPSAQWEHTIAITETGYEILTLLND

map

Methionine aminopeptidase

291 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

32.641 kDa

MKRNDPCWCGSNKKWKHCHYPTKPERPLDNLRQLYASRYDIIIKTPEQIEKIRKACQVTAHILDALCEAAKEGVTTNELDLLSRELHKRHNAIPAPLNYGHPPFPKTICTSLNEVICHGIPNDIPLQNGDIMNIDVSCIVDGFYGDCSRMVMIGEVSEIKRKVCEASLEALNAAISILEPNLPLYEIGEVIENCAAKYGFSVVDQFVGHGVGVKFHENPFVAHHRNSCKIPLAPGMIFTIEPMINVGKKEGFIDPINHWEARTCDHQPSAQWEHAILITDSGCEVLTLLDK

map

Methionine aminopeptidase

291 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

31.691 kDa

MDDEVREKLIEAGKILKQAVNEAAEKIAPGVKILEVAEFVENRIIELGAKPAFPANISINSDAAHFTPKKNDERTFKEGDVVKLDVGAHIDGYIADMAVTVDLGDNTELVKAAKEALEAAMEVVRAGVSVSEIGKAIEDAITNYGFKPIVNLTGHGLLPYLNHAPPSIYNYATEKGVTLEEGMVVAIEPFATNGVGKVGERGECEIYSLLNPRPVRMKMAREILKEVEENYKTLPFAKRWLKKAPDIIISKLAREGVLRAYPVLTEVSGGLVSQWEHTLIVEDGGATITTK

map

Methionine aminopeptidase

285 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

30.891 kDa

MPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL

map

Methionine aminopeptidase

285 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

30.891 kDa

MPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL

map

Methionine aminopeptidase 2

285 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

30.891 kDa

MPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL

map

Methionine aminopeptidase 2

285 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

30.891 kDa

MPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL

map

Methionine aminopeptidase

268 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.896 kDa

MAIPIRTEKEIVKLREACKLASDVLVMIEPYVKAGVTTGELDRICHEYMVNEQKVIPACLNYHGFPKATCISINEVVCHGIPSDDKVLKNGDIVNIDVTVIKDGYFGDNSKMYIVGGETNIRSKKLVEAAQEALYVGIRTVKPDIRLNEIGKAVQKYTESQTFSVVREYCGHGVGTEFHCEPQVLHYYADDGGVILKPGMVFTIEPMINAGKKEVRVMGDGWTVKTKDRSHSAQYEHQLIVTETGCEVMTIRDEEIAEGRISRIMVNV

map

Methionine aminopeptidase

266 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

30.049 kDa

MTCIFIKNINEINKMRLVGKLVADVLDMIKEYIVPGITTEELNNICHNYITYKQHAKPACLGYQGFPKSICTSINDIVCHGIPNKNSILKNGDIINIDVAILKDKYYSDASKMFFVGKPTELGKKLCYVAKKSLYLALYTIRPGINLQKLGKVIQNYVKKQNFSIVKEYCGHGIGRSFHEPPQILHHNYYKSNTTILQSGMTFTVEPMINSGSCEVQCTNDGWTVKTKDKSLSAQYEHTILVNEEGCEILTLQKGEQISRILKNLT

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.292 kDa

MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.292 kDa

MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.331 kDa

MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.292 kDa

MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.292 kDa

MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.331 kDa

MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

30.012 kDa

MSCIIKTESEIKKMRISGKLAAEVLEMIKEHLQPKISTEDINQICHDYIVYKKKAISACLGYHGFPKSICISINDVVCHGIPSKNQVFKEGDIVNIDIAIIKDGYHGDTSKMFYIGKTSILSKRLCQVARESLYLSLKLVKPGIPLYKIGEIIQNYVESNNFSVVKEYCGHGIGRNFHEEPHVLHYKNKKNNIILKKGMIFTIEPMINSGNPEVKCMKDGWTVKTKDRSLSAQYEHTVLVTEYGCDILTWQKDEDISQKLVNIN

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.331 kDa

MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.331 kDa

MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE

map

Methionine aminopeptidase

264 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.331 kDa

MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE

map

Methionine aminopeptidase

261 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.553 kDa

MNCIIKTESEIKKMKVSGKIAAEVLEMIENYIKPNISTEEINNICHNFIIKKKAVSACLGYHGFPKSICISVNDVVCHGIPNKNQILKSGDIVNIDVTIIKKNYHADTSKMFLVGQTNILSQRLCKIAQESLYKSLNILKPGIPLYKIGEVIQNYVENNNFSVVKEYCGHGIGRAFHEEPYVLHYKNKSHVILEKGMIFTIEPMINAGSHEVKCMKDGWTVKTKDHSLSAQYEHTVLITENGCDILTWQKNEKIPSKFINK

map

Methionine aminopeptidase

259 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

28.861 kDa

MTIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY

map

Methionine aminopeptidase

259 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

28.861 kDa

MTIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY

map

Methionine aminopeptidase

258 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

28.185 kDa

MAIELYSQREIEKIRKASQIVAEVLHIVAENVKPGVSTWDLEMIARKETEKRGAKPAFLGYKPPFSDVRYPAALCISINDEVVHGLPKKEKVIKEGDVVSIDFGAIYDGYAGDSAITVIAGKGSPEAQKLLEATKEALYNAIEKALPGKKVGDITKAIHETAEKYGFKTILRYGGHGVGRKVHQEPFVPNNVKDIGKKNPRLRQGMVIAIEPMLSIGTEETVEDGDGWTVKTKDGSLAAHFEHTVAITKKGPVILTEL

map

Methionine aminopeptidase

255 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.316 kDa

MIRIKTPEQIDGIRASCKALARLFDVLIPLVKPGVQTQELDAFCQRFIRSVGGVPAWFSEGFPAAACISINEEVIHGLPSARVIQDGDLVSLDVGINLNGYISDACRTVPVGGVAHERLELLRVTTECLRAGIKACRAGARVRAVSRAVYAVAARHRFGVVYEYCGHGVGLAVHEEPNIPNVPGLEGPNPRFLPGMVVAIEPMLTLGTDEVRTSADGWTVVTADGSCACHVEHTVAVFADHTEVLTEPTEVERTG

map

Methionine aminopeptidase

253 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.464 kDa

MAISIKSPKEIKALRKAGELTAQALALLEREVRPGVSLLELDKMAEDFIKSSHARPAFKGLYGFPNSVCMSLNEVVIHGIPTDYVLQEGDIIGLDLGVEVDGYYGDSALTLPIGAISPQDEKLLACSKESLMHAISSIRVGMHFKELSQILEGAITERGFVPLKGFCGHGIGKKPHEEPEIPNYLEKGVKANSGPKIKEGMVFCLEPMVCQKQGEPKILADKWSVVSVDGLNTSHHEHTIAIVGNKAVILTER

map

Methionine aminopeptidase

253 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.577 kDa

MAISIKSPKEIKALRKAGELTAQALALLEREVRPGVSLLELDKMAEDFIKSSHARPAFKGLYGFPNSVCMSLNEVVIHGIPTDYVLQEGDIIGLDLGVEVDGYYGDSALTLPIGAISPQDEKLLACSKESLMHAINSIRVGMHFKELSQILESTITERGFVPLKGFCGHGIGKKPHEEPEIPNYLEKGVKPNSGPKIKEGMVFCLEPMVCQKQGEPKILADKWSVVSVDGLNTSHHEHTIAIVGNKAVILTER

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

252 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.502 kDa

MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE

map

Methionine aminopeptidase

251 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

28.036 kDa

MITIKNQEQIQKMKIAGQVLAKGLNLLKSMIKPGVNCLDLDKAFEEFIKQNGCESNFKNYQGFPKTICISINDQLIHGIPRDRVLLDGDVVSIDAGCMYEKWHADSAFTMVCGIAKNKKNDILIRVTEEALELAIAELKPGIRVGTIGSIIQNYVESFDFSVPRDYTGHGIGLALHEDPYIPNYGIPNTGIRLQEGMVICIEPMVQMGTYKTKIADDKWTVYSADHSITAHFEHTILITKDGCEVLTKTER

map

Methionine aminopeptidase

251 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

28.036 kDa

MITIKNQEQIQKMKIAGQVLAKGLNLLKSMIKPGVNCLDLDKAFEEFIKQNGCESNFKNYQGFPKTICISINDQLIHGIPRDRVLLDGDVVSIDAGCMYEKWHADSAFTMVCGIAKNKKNDILIRVTEEALELAIAELKPGIRVGTIGSIIQNYVESFDFSVPRDYTGHGIGLALHEDPYIPNYGIPNTGIRLQEGMVICIEPMVQMGTYKTKIADDKWTVYSADHSITAHFEHTILITKDGCEVLTKTER

map

Methionine aminopeptidase

251 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.531 kDa

MIVKTDEELQALKEIGYICAKVRDTMKEATKPGVTTRELDHIAKDLFEEHGAISAPIHDENFPGQTCISVNEEVAHGIPGKRVIHEGDLVNIDVSALKNGYYADTGISFVVGKSDQPLKQKVCDVATMAFENAMKKVKPGTKLSNIGKAVHATARQNDLTVIKNLTGHGVGQSLHEAPNHVMNYFDPKDKTLLKEGQVIAVEPFISTHATFVTEGKNEWAFETKDKSYVAQIEHTVIVTKDGPLLTTKIDD

map

Methionine aminopeptidase

251 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.55 kDa

MIVKTDEELQALKEIGYICAKVRDTMKEATKPGVTTRELDHIAKDLFEEHGAISAPIHDENFPGQTCISVNEEVAHGIPGKRVIREGDLVNIDVSALKNGYYADTGISFVVGKSDQPLKQKVCDVATMAFENAMKKVKPGTKLSNIGKAVHATARQNDLTVIKNLTGHGVGQSLHEAPNHVMNYFDPKDKTLLKEGQVIAVEPFISTHATFVTEGKNEWAFETKDKSYVAQIEHTVIVTKDGPLLTTKIDD

map

Methionine aminopeptidase

251 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.711 kDa

MTKLRLKSKDEIKKIKASASLLALTLLEVERNIVPGISTKELDLIAYDFIIKNRAKPAFKGYRGFKGTICASVNEEVIHGIPGKRKLADGDIVSIDCGVILDGFYSDMAKTFKVGNVDSSIDKLLEVTNASLYKGIAEMKVGNRILNISKAIEDYIKPFGFGIVREYTGHGVGFELHEEPSVPNYYAPFFKNIRIQEGMVLAIEPMVNLRGHKVSIKSDGWTVFASDLSYSAHFEHTVAVVDGLPLILSEV

map

Methionine aminopeptidase

250 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.026 kDa

MIYIKNPNEIQKIKNAAQIYKKIVKQFNFDYIKNKSLKEIDQMLRDFVSQHHANSCYHGYLGFKGYHCLSLNQTIIHGLANDEIFTSKDKLTIDIGIELDNYYCDSAFTILGPDVNPRQKLLSEVTHNCIFELVKKIVPNQTTTNDLGIWTEEYAKKYGYSVIKDFGGHGCGIKIHEDPIILNYGTKKSSELLTPNMVICIEPMFFEKDNRYYIDPDDSWSVKPVNKNQYVCHWEHMVLIKEDQAEILTL

map

Methionine aminopeptidase

250 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

29.026 kDa

MIYIKNPNEIQKIKNAAQIYKKIVKQFNFDYIKNKSLKEIDQMLRDFVSQHHANSCYHGYLGFKGYHCLSLNQTIIHGLANDEIFTSKDKLTIDIGIELDNYYCDSAFTILGPDVNPRQKLLSEVTHNCIFELVKKIVPNQTTTNDLGIWTEEYAKKYGYSVIKDFGGHGCGIKIHEDPIILNYGTKKSSELLTPNMVICIEPMFFEKDNRYYIDPDDSWSVKPVNKNQYVCHWEHMVLIKEDQAEILTL

map

Methionine aminopeptidase

250 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.301 kDa

MIIIKNDTEIEYMRQAGKIVGETLNMLEKAAKPGVTTADLDRLAEDFIKKYNAIPSFKGYGGFPASICTSINEEVIHGIPSKHRVLHEGDIISVDCGAILNGYQGDAARTFAIGEISEEAAKLIKVTKESFFKGVEKAVIGNRLTDISHSIQEYVESFGYGVVRDYVGHGIGKEMHEDPEVPNYGRPGRGPKLVHGMVLAIEPMVDVGTYMVKTQSNDWTVVTQDGSLAAHYENTVAILDNGPEILTLCE

map

Methionine aminopeptidase

249 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.323 kDa

MIILKNENEIDLMRKAGKILGETLNLLKEKVRPGITTTELDRIAEEFITKHGATPSFKGLYGFPASLCISVNNQVIHGFPGSYELKDGDIVSIDCGVCLNGFHSDAARTFGVGNISEEAEKLIRITEESFFKGIEKAYVDNRLTDISNEIQQYVEANGFSVVRDFVGHGIGRKVHEDPEVPNFGRPGRGPKLMAGMVLAIEPMVNMGSYRVKTLDDGWTVVTADGKLSAHYENTVAILPNGPEILTLIK

map

Methionine aminopeptidase

248 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.738 kDa

MIYLKSANEVAGIKKACAIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIEQKQAKCAFHGYLGFPGFNCLSLNQTVIHGVADQTVFKDSDKLTLDIGIDYHGYLCDAAFTLLGNKADPKAVKLLNDVEQAFSKVIEPELFVNNPIGNLSNAIQTYFENKGYFLVKEFGGHGCGIKIHEDPLILNWGEKNQGVRLQEGMVICIEPMVMTDSSEITMAANNWNVLTLKSKFNCHVEQMYHITNNGFECLTN

map

Methionine aminopeptidase

248 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.657 kDa

MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN

map

Methionine aminopeptidase

248 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.738 kDa

MIYLKSANEVAGIKKACAIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIEQKQAKCAFHGYLGFPGFNCLSLNQTVIHGVADQTVFKDSDKLTLDIGIDYHGYLCDAAFTLLGNKADPKAVKLLNDVEQAFSKVIEPELFVNNPIGNLSNAIQTYFENKGYFLVKEFGGHGCGIKIHEDPLILNWGEKNQGVRLQEGMVICIEPMVMTDSSEITMAANNWNVLTLKSKFNCHVEQMYHITNNGFECLTN

map

Methionine aminopeptidase

248 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.657 kDa

MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN

map

Methionine aminopeptidase 1

248 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.409 kDa

MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAERFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHGDSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVREYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVTVDGKKCAHFEHTIAITETGFDILTRV

map

Methionine aminopeptidase

248 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

27.155 kDa

MIICKTERELEIMREAGRIVALTHQEIKLHIQPGITTKKLDEIAETFIRSHGATPSFKGYNGFTGSICASVNEELVHGIPGNRVLKEGDIISVDIGAKYNGYHGDSAWTYAVGNISDEDQDLLDVTETSLYKGLEQAKAGARLSDISHAIQSYAEPRGYAIVREYVGHGVGQNLHEDPQIPHYGPPGKGPRLKPGMVLAIEPMVNAGSRYVRTLSDNWTVVTVDGKKCAHFEHTIAITETGYEILTKA

map

Methionine aminopeptidase

188 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val) (By similarity).

Belongs to the peptidase M24A family. Methionine aminopeptidase archaeal type 2 subfamily.

20.713 kDa

single

MEKFKKAGKIASKVRKKAIKAVKGEMKILDLAEFIENEIEKMGAKPAFPCNISVNEITAHYSPPCNDDRKILPGDLVKIDIGVHVDGFIGDTATTVLVEGYEDLKNYNDELAEKNKKMIEAAESALENAINTIRDGVEIGKIGEVIENTINKFGFKPISNLTGHTIDRWVLHSGLSIPNVKGQNSHKL

map

Methionine aminopeptidase

51 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed (By similarity).

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

5.698 kDa

single

MIICKTAHEITLMREAGKIVSATLEELKNHIRPGVTTKELDAIAEEVIRSH

map

Methionine aminopeptidase

43 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed (By similarity).

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

4.826 kDa

single

TVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHNE

map

Methionine aminopeptidase

43 amino acids

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed (By similarity).

Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

4.826 kDa

single

TVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHNE