About Products Protein Database Contact

Protein expression services for map | Methionine aminopeptidase

Description
Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Family
Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.
Species
Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Length
251 amino acids
Sequence
MITIKNQEQIQKMKIAGQVLAKGLNLLKSMIKPGVNCLDLDKAFEEFIKQNGCESNFKNYQGFPKTICISINDQLIHGIPRDRVLLDGDVVSIDAGCMYEKWHADSAFTMVCGIAKNKKNDILIRVTEEALELAIAELKPGIRVGTIGSIIQNYVESFDFSVPRDYTGHGIGLALHEDPYIPNYGIPNTGIRLQEGMVICIEPMVQMGTYKTKIADDKWTVYSADHSITAHFEHTILITKDGCEVLTKTER
Mass
28 kDa
Simulated SDS-PAGE
Western blot of map recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make map using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here