macA

Macrolide export protein MacA

371 amino acids

Part of the tripartite efflux system MacAB-TolC. MacA stimulates the ATPase activity of MacB by promoting the closed ATP-bound state of MacB, increases the capacity of MacB to bind macrolides such as erythromycin, and provides a physical link between MacB and TolC. Confers resistance against macrolides (By similarity).

Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.

40.639 kDa

MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSLQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEVVIGEAKPGAAQ

macA

Macrolide export protein MacA

371 amino acids

Part of the tripartite efflux system MacAB-TolC. MacA stimulates the ATPase activity of MacB by promoting the closed ATP-bound state of MacB, increases the capacity of MacB to bind macrolides such as erythromycin, and provides a physical link between MacB and TolC. When overexpressed, the system confers resistance against macrolides composed of 14- and 15-membered lactones but no or weak resistance against 16-membered ones. In addition, MacA binds tightly rough-core lipopolysaccharide (R-LPS), suggesting that the system could also transport R-LPS or a similar glycolipid.

Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.

40.624 kDa

MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEVVIGEAKPGAAQ

macA

Macrolide export protein MacA

371 amino acids

Part of the tripartite efflux system MacAB-TolC. MacA stimulates the ATPase activity of MacB by promoting the closed ATP-bound state of MacB, increases the capacity of MacB to bind macrolides such as erythromycin, and provides a physical link between MacB and TolC. Confers resistance against macrolides (By similarity).

Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.

40.639 kDa

MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSLQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEVVIGEAKPGAAQ

macA

Macrolide export protein MacA

371 amino acids

Part of the tripartite efflux system MacAB-TolC. MacA stimulates the ATPase activity of MacB by promoting the closed ATP-bound state of MacB, increases the capacity of MacB to bind macrolides such as erythromycin, and provides a physical link between MacB and TolC. Confers resistance against macrolides (By similarity).

Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.

40.186 kDa

MMQLSRGQRRWLAAIAVLLIGGFFIARHLMAPVPVNYQTVKVVHRDLQQNVLATGKLDAVRKVDVGAQVSGQLEKLYVEIGDHVKRGQLLAMIDPQQAQNQIKEVEATLQDLNAQRIQAKAELHLATVTLGRQQNLAKLQVVSRQDLDQAVTDLAVKNAKVGTIDAQINKAKASLDTAKINLDYTQISAPMDGDVVQITTLQGQTVIAAQQAPNILTLADMSTMLVQAQVSEADVINLKPGMKASFTVLGDPGKRFSGVLKDILPTPEKVNDAIFYSARFEVPNPDRLLRLQMTAQVSIQLANVDQAVVIPLAALGDELGSNRYQVTVLKEGKEEKREVTIGIRNNVDAQVISGLSVGEDVIVSRGGTGDA

macA

Maleylacetate reductase 1

357 amino acids

Plays a major role in the degradation of chloroaromatic compounds by channeling maleylacetate and some of its substituted derivatives into the 3-oxoadipate pathway. This enzyme converts maleylacetate and 2-chloromaleylacetate with similar efficiencies.

Belongs to the iron-containing alcohol dehydrogenase family.

37.798 kDa

MAERSSEFVFTGNPARVIFGAGRMRNVREEVERLGRGRVLLLGSENLREVCDQVQDLLGELFVNRYDGAAMHTPVEVTDIALAQLRTSEADCVVAIGGGSTTGLAKALAARTGVDQVILPTTYAGSEVTPVLGETVEGRKTTRSTLAVLPETVIYDVELSKNLPVPIAVASAVNALAHAVEAMYSPDANPVVDTWALEAAQALARGLRGLVSDPSCRRIRTDLLRGSWLAGMCLGSVGMAVHHKLCHTLGGAFGLPHAPTHTVVLPYAMSFNASEVPDVMDSLASAMNVSNAPAGVWDLIADAGGPTSLASLGLLQTDLDRAADLATEAPYRNPRQITRSGIRDLLQSAWEGNRPPE