Description
Part of the tripartite efflux system MacAB-TolC. MacA stimulates the ATPase activity of MacB by promoting the closed ATP-bound state of MacB, increases the capacity of MacB to bind macrolides such as erythromycin, and provides a physical link between MacB and TolC. Confers resistance against macrolides (By similarity).
Family
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Sequence
MMQLSRGQRRWLAAIAVLLIGGFFIARHLMAPVPVNYQTVKVVHRDLQQNVLATGKLDAVRKVDVGAQVSGQLEKLYVEIGDHVKRGQLLAMIDPQQAQNQIKEVEATLQDLNAQRIQAKAELHLATVTLGRQQNLAKLQVVSRQDLDQAVTDLAVKNAKVGTIDAQINKAKASLDTAKINLDYTQISAPMDGDVVQITTLQGQTVIAAQQAPNILTLADMSTMLVQAQVSEADVINLKPGMKASFTVLGDPGKRFSGVLKDILPTPEKVNDAIFYSARFEVPNPDRLLRLQMTAQVSIQLANVDQAVVIPLAALGDELGSNRYQVTVLKEGKEEKREVTIGIRNNVDAQVISGLSVGEDVIVSRGGTGDA
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service