l(2)37Cg

Probable DNA-directed RNA polymerases I and III subunit RPAC2

105 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity).

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

11.868 kDa

MGALAELAGDEKNGEGSRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNAMKVEN