DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity).

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

105 amino acids

MGALAELAGDEKNGEGSRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNAMKVEN

11.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make l(2)37Cg using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here