grdA

Glycine/sarcosine/betaine reductase complex component A

158 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdA family.

17.14 kDa

MSRFTGKKIVIIGDRDGIPGPAIEECLKPIDCEVIFSSTECFVUTAAGAMDLENQKRIKEATEKFGAENLVVLIGAAEAEAAGLAAETVTAGDPTFAGPLAGVELGLRVYHAVEPEFKDEVDAQIFDDQVGMMEMVLNVDEIIEEMQSIRSQFCKFND

grdA

Glycine/sarcosine/betaine reductase complex component A

158 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdA family.

16.991 kDa

MSLFDGKKVIIIGDRDGIPGPAMEECLKGTGAEVVYSSTECFVUTAAGAMDLENQKRVMDLTEKHNAENVVVILGAAEAEAAGLAAETVTNGDPTFAGPLAGVQLGLRVYHAVEPQFKDAVNAEVYEDQIGMMEMVLEVDAIIEEMSNIRNEFGKFKD

grdA

Glycine/sarcosine/betaine reductase complex component A

158 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdA family.

17.221 kDa

MSLFEGKKVIIIGDRDGIPGPAIEKCIEGTGAEVVFSSTECFVUTAAGAMDLENQKRVKTLTEKHGAENILVILGAAEGEAAGLAAETVTNGDPTFAGPLSNVQLGLRVYHAVEPEFKEEVNEEVYEEEIGMMEMVLEVDEIIEEMTDIRTEFCKFLD

grdA

Glycine/sarcosine/betaine reductase complex component A

158 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdA family.

17.221 kDa

MSLFEGKKVIIIGDRDGIPGPAIEKCIEGTGAEVVFSSTECFVUTAAGAMDLENQKRVKTLTEKHGAENILVILGAAEGEAAGLAAETVTNGDPTFAGPLSNVQLGLRVYHAVEPEFKEEVNEEVYEEEIGMMEMVLEVDEIIEEMTDIRTEFCKFLD

grdA

Glycine/sarcosine/betaine reductase complex component A

158 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdA family.

16.909 kDa

MSLFDGKKVIIIGDRDGIPGPAMAECLKGINVEVVYSATECFVUTAAGAMDLENQNWVKNFTDQYGAENIIVLVGAAEAESAGLAAETVTAGDPTFAGPLAGVQLGLRVFHAVEPEFKGAVDSAIYDEQIGMMEMVLDVDSIIEEMKSIRADYCKFND

grdA

Glycine/sarcosine/betaine reductase complex component A

157 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination (By similarity).

Belongs to the GrdA family.

16.711 kDa

MVDLKTKKVIIIGDRDGVPGEAIKLCAESAGAEVVYAATECFVUTSAGAMDLENQKRVKDLAEKYGPENVIVLLGGAEAESSGLACETVTVGDPTFAGPLAGVSLGLLCYHVAEPEIKSQIDPAVYEEQVSMMEMVMDVNAIIAEISEYRNKGCKFL

grdA

Glycine/sarcosine/betaine reductase complex component A

156 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination (By similarity).

Belongs to the GrdA family.

16.198 kDa

MAILAGKKVIAVGDRDGVPGPAIAECAKSAGAEVVFATTECFVUTAAGTMDLQNQARIKELAEELGGENIVVLLGAAEPDTASLAAETVTLGDPTFAGPLAGVSLGLKVYHILEPEIKAEIDPAVYEEQAAMMEMVLDVDALAAEVSKMRKEGSKY

grdA

Glycine/sarcosine/betaine reductase complex component A

155 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination (By similarity).

Belongs to the GrdA family.

16.786 kDa

MELKGKKAIILGDRDGIPGPALEACVRSAGAEVVFASTECFVUTSAGAMDMENQRRVKELAEKYPKEDLVVILGGAEAEASGLAAETVSNGDPAWAGPLAGVQLGLKAYHIFEPEIKEQIDPNVYEEQVSLMEMVLDVEAIVQEVRSIREKYAAW

grdA

Glycine/sarcosine/betaine reductase complex component A

150 amino acids

In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdA family.

15.762 kDa

MILQGKKVIAIGDRDGIPGPAIEECVKSAGAEIAFSSTECFVUTAAGAMDLEIQQKVKDAAESIGADNLVVVLGGAEAESSGLSAETVTTGDPTYAGPLAGVELGLKVYHVVEDELKAEFDEAIYEDQCGMMEMVLDVDGIKEEMNRVRG