Description
In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.
Family
Belongs to the GrdA family.
Species
Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Sequence
MSLFEGKKVIIIGDRDGIPGPAIEKCIEGTGAEVVFSSTECFVUTAAGAMDLENQKRVKTLTEKHGAENILVILGAAEGEAAGLAAETVTNGDPTFAGPLSNVQLGLRVYHAVEPEFKEEVNEEVYEEEIGMMEMVLEVDEIIEEMTDIRTEFCKFLD
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service