geoA

Geraniol dehydrogenase

373 amino acids

Catalyzes the NAD(+)-dependent oxidation of geraniol to geranial. Is involved in the anaerobic degradation of the monoterpene beta-myrcene. Can also catalyze the oxidation of (S)-perillyl alcohol to perillyl aldehyde, and to a lesser extent, the oxidation of nerol, citronellol, cumic alcohol, and benzyl alcohol. Cannot use NADP(+) instead of NAD(+) as cosubstrate.

Belongs to the zinc-containing alcohol dehydrogenase family.

38.274 kDa

MNDTQDFISAQAAVLRQVGGPLAVEPVRISMPKGDEVLIRIAGVGVCHTDLVCRDGFPVPLPIVLGHEGSGTVEAVGEQVRTLKPGDRVVLSFNSCGHCGNCHDGHPSNCLQMLPLNFGGAQRVDGGQVLDGAGHPVQSMFFGQSSFGTHAVAREINAVKVGDDLPLELLGPLGCGIQTGAGAAINSLGIGPGQSLAIFGGGGVGLSALLGARAVGADRVVVIEPNAARRALALELGASHALDPHAEGDLVAAIKAATGGGATHSLDTTGLPPVIGSAIACTLPGGTVGMVGLPAPDAPVPATLLDLLSKSVTLRPITEGDADPQRFIPRMLDFHRAGKFPFDRLITRYRFDQINEALHATEKGEAIKPVLVF

geoA

Geraniol dehydrogenase

373 amino acids

Catalyzes the NAD(+)-dependent oxidation of geraniol to geranial. Is involved in the anaerobic degradation of the monoterpene beta-myrcene. Can also catalyze the oxidation of (S)-perillyl alcohol to perillyl aldehyde, and to a lesser extent, the oxidation of nerol, citronellol, cumic alcohol, and benzyl alcohol. Cannot use NADP(+) instead of NAD(+) as cosubstrate.

Belongs to the zinc-containing alcohol dehydrogenase family.

38.274 kDa

MNDTQDFISAQAAVLRQVGGPLAVEPVRISMPKGDEVLIRIAGVGVCHTDLVCRDGFPVPLPIVLGHEGSGTVEAVGEQVRTLKPGDRVVLSFNSCGHCGNCHDGHPSNCLQMLPLNFGGAQRVDGGQVLDGAGHPVQSMFFGQSSFGTHAVAREINAVKVGDDLPLELLGPLGCGIQTGAGAAINSLGIGPGQSLAIFGGGGVGLSALLGARAVGADRVVVIEPNAARRALALELGASHALDPHAEGDLVAAIKAATGGGATHSLDTTGLPPVIGSAIACTLPGGTVGMVGLPAPDAPVPATLLDLLSKSVTLRPITEGDADPQRFIPRMLDFHRAGKFPFDRLITRYRFDQINEALHATEKGEAIKPVLVF

geoA

(+)-eremophilene synthase

329 amino acids

Catalyzes the conversion of (2E,6E)-farnesyl diphosphate (FPP) to yield the bicyclic sesquiterpene eremophilene via a 1,10-cyclization, which requires the abstraction of the pyrophosphate from FPP to yield the (E,E)-germacradienyl cation. The only accepted substrate is farnesyl diphosphate (FPP).

Belongs to the terpene synthase family.

38.073 kDa

MSSDRTSVVVSKRDAGGFEYPFAASCHPGREVTEQRTLAWVRRLRLVPDGRSLSRLKATNFSHLAAWLLPSASTQTLQLASDFTAVLFLLDDAYDEGQLSTDPESVEWLNEKYLGELFGYTEADMSDPLTRGMLDVRERIRRSHPHFFLNRWLSHFQYYYEANLWEANNRKQMRVPHLEEYLMMRRYSGAVYTYCDLLELLLERPLPLEVVQHPLIQTVRDICNDILCWTNDYFSLGKELTNGETHNLIVVLRNECVSTLEEAIDRLKDMHDRRVAEYQGVKEKVLALWADDEIRLYLDAVEAMIAGNQRWALEAGRYSGLESLIVRAG

geoA

(+)-eremophilene synthase

329 amino acids

Catalyzes the conversion of (2E,6E)-farnesyl diphosphate (FPP) to yield the bicyclic sesquiterpene eremophilene via a 1,10-cyclization, which requires the abstraction of the pyrophosphate from FPP to yield the (E,E)-germacradienyl cation. The only accepted substrate is farnesyl diphosphate (FPP).

Belongs to the terpene synthase family.

38.073 kDa

MSSDRTSVVVSKRDAGGFEYPFAASCHPGREVTEQRTLAWVRRLRLVPDGRSLSRLKATNFSHLAAWLLPSASTQTLQLASDFTAVLFLLDDAYDEGQLSTDPESVEWLNEKYLGELFGYTEADMSDPLTRGMLDVRERIRRSHPHFFLNRWLSHFQYYYEANLWEANNRKQMRVPHLEEYLMMRRYSGAVYTYCDLLELLLERPLPLEVVQHPLIQTVRDICNDILCWTNDYFSLGKELTNGETHNLIVVLRNECVSTLEEAIDRLKDMHDRRVAEYQGVKEKVLALWADDEIRLYLDAVEAMIAGNQRWALEAGRYSGLESLIVRAG