Catalyzes the conversion of (2E,6E)-farnesyl diphosphate (FPP) to yield the bicyclic sesquiterpene eremophilene via a 1,10-cyclization, which requires the abstraction of the pyrophosphate from FPP to yield the (E,E)-germacradienyl cation. The only accepted substrate is farnesyl diphosphate (FPP).

Belongs to the terpene synthase family.

329 amino acids

MSSDRTSVVVSKRDAGGFEYPFAASCHPGREVTEQRTLAWVRRLRLVPDGRSLSRLKATNFSHLAAWLLPSASTQTLQLASDFTAVLFLLDDAYDEGQLSTDPESVEWLNEKYLGELFGYTEADMSDPLTRGMLDVRERIRRSHPHFFLNRWLSHFQYYYEANLWEANNRKQMRVPHLEEYLMMRRYSGAVYTYCDLLELLLERPLPLEVVQHPLIQTVRDICNDILCWTNDYFSLGKELTNGETHNLIVVLRNECVSTLEEAIDRLKDMHDRRVAEYQGVKEKVLALWADDEIRLYLDAVEAMIAGNQRWALEAGRYSGLESLIVRAG

38.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make geoA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here