gbuB

Glycine betaine/carnitine transport permease protein GbuB

282 amino acids

Part of the ABC transporter complex GbuABC involved in glycine betaine uptake. Responsible for the translocation of the substrate across the membrane. Involved, with BetL and OpuC, in osmoprotection and cryoprotection of Listeria. Can also uptake carnitine when carnitine is abundant in the growth medium.

Belongs to the binding-protein-dependent transport system permease family.

30.919 kDa

MPNIPTIPLASWIDKLVDGLTQFEGFFNVITNIIGGIVDAFQWVFDLVPPWLFIILLVFGTFWVNRKGKKWGLIIFEVVGLLLIWNLDFWRDMTQTLTLVLTSSLIALVIGVPLGIWMAKSNIVESIFKPVLDFMQTMPAFVYLIPAVAFFGIGMVPGVVASVIFAMPPTVRMTNLGIRQVSTELVEAADSFGSTPWQKLWKVQLPMAKSTMMAGINQSIMLALSMVVIASMIGAMGLGTRVYFAVGRNDAGGGFVAGIAIVIVAIILDRLTQAFNKKAKSE