Part of the ABC transporter complex GbuABC involved in glycine betaine uptake. Responsible for the translocation of the substrate across the membrane. Involved, with BetL and OpuC, in osmoprotection and cryoprotection of Listeria. Can also uptake carnitine when carnitine is abundant in the growth medium.

Belongs to the binding-protein-dependent transport system permease family.

282 amino acids

MPNIPTIPLASWIDKLVDGLTQFEGFFNVITNIIGGIVDAFQWVFDLVPPWLFIILLVFGTFWVNRKGKKWGLIIFEVVGLLLIWNLDFWRDMTQTLTLVLTSSLIALVIGVPLGIWMAKSNIVESIFKPVLDFMQTMPAFVYLIPAVAFFGIGMVPGVVASVIFAMPPTVRMTNLGIRQVSTELVEAADSFGSTPWQKLWKVQLPMAKSTMMAGINQSIMLALSMVVIASMIGAMGLGTRVYFAVGRNDAGGGFVAGIAIVIVAIILDRLTQAFNKKAKSE

30.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gbuB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here