esc

Polycomb protein esc

428 amino acids

Polycomb group (PcG) protein. In contrast to other PcG protein, it is specifically required during the first 6 hours of embryogenesis to establish PcG silencing. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via a methylation of histones, rendering chromatin heritably changed in its expressibility. Component of the Esc/E(z) complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. The Esc/E(z) complex is necessary but not sufficient to recruit a functional PcG repressive complex that represses target genes, suggesting that the recruitment of the distinct PRC1 complex is also required to allow a subsequent repression (By similarity).

Belongs to the WD repeat ESC family.

48.796 kDa

MSKVKADKQSPKENTKAENSDNESIDDTASVATSTTSRSKSPGSRGRRQSRGHSKSKAKRPAYKYDCHLKEDHGQAIFGVSFNHLLGKDQSMVFATAGSNRCNIYECPRKGGLKLIMCYADPDPDEVFYTCSWSYDLKTSAPLLATAGYRGVIRVIDIHRNESVGNYVGHGQAINELKFHPRQANLLLSGSKDHAIRLWNIQTHVCIAIFGGVEGHRDEVLSIDFDLRGERIMSSGMDHSLKLWRIDTPEFKDKIEMSRTFNPNKSQLPFPTIMQHFPEFSTRDIHRNYVDCVQWFGDFVLSKSCENSIVCWKPGQLHQTLSQLKPNDPSCTIISEFNYDECEIWFVRFGFNPWHKIVALGNQYGKVYVWELDPSDPRHTHSSTLNNIRCTSIVRQTAFSRDATVLVWVCDDGTVWRWNRRNAEVHTP

esc

Polycomb protein esc

425 amino acids

Polycomb group (PcG) protein. While PcG proteins are generally required to maintain the transcriptionally repressive state of homeotic genes throughout development, this protein is specifically required during the first 6 hours of embryogenesis to establish the repressed state. Component of the Esc/E(z) complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3, leading to transcriptional repression of the affected target gene. The Esc/E(z) complex is necessary but not sufficient for the repression of homeotic target genes, suggesting that the recruitment of the distinct PRC1 complex is also required.

Belongs to the WD repeat ESC family.

47.988 kDa

MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI

esc

Polycomb protein esc

425 amino acids

Polycomb group (PcG) protein. In contrast to other PcG protein, it is specifically required during the first 6 hours of embryogenesis to establish PcG silencing. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via a methylation of histones, rendering chromatin heritably changed in its expressibility. Component of the Esc/E(z) complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. The Esc/E(z) complex is necessary but not sufficient to recruit a functional PcG repressive complex that represses target genes, suggesting that the recruitment of the distinct PRC1 complex is also required to allow a subsequent repression (By similarity).

Belongs to the WD repeat ESC family.

48.043 kDa

MSSEKVKNDNEPDDTDDSCGDESASFTTNSTTSRSKSPASSTRSKRRGRRSHKSKPKSGAAYKYDTHVKENHGANIFGVSFNTLLGKDEPQVFATAGSNRCTVYECPRKGGLTLLHCYADPDPDEVFYTCAWSYDLKTSAPLLAAAGYRGVIRVIDIEQNEAVDNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQTHVCIAIFGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTQEFQHKIELSQTFSQEKSTLPFPTITKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQLKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWEMDPSDPEGAHMTTLHNLRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRHAAAI