Polycomb group (PcG) protein. In contrast to other PcG protein, it is specifically required during the first 6 hours of embryogenesis to establish PcG silencing. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via a methylation of histones, rendering chromatin heritably changed in its expressibility. Component of the Esc/E(z) complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. The Esc/E(z) complex is necessary but not sufficient to recruit a functional PcG repressive complex that represses target genes, suggesting that the recruitment of the distinct PRC1 complex is also required to allow a subsequent repression (By similarity).

Belongs to the WD repeat ESC family.

425 amino acids

MSSEKVKNDNEPDDTDDSCGDESASFTTNSTTSRSKSPASSTRSKRRGRRSHKSKPKSGAAYKYDTHVKENHGANIFGVSFNTLLGKDEPQVFATAGSNRCTVYECPRKGGLTLLHCYADPDPDEVFYTCAWSYDLKTSAPLLAAAGYRGVIRVIDIEQNEAVDNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQTHVCIAIFGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTQEFQHKIELSQTFSQEKSTLPFPTITKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQLKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWEMDPSDPEGAHMTTLHNLRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRHAAAI

48 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make esc using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here